KEGG   Cavenderia fasciculata (cellular slime mold): DFA_07246Help
Entry
DFA_07246         CDS       T02668                                 

Gene name
lig1
Definition
(RefSeq) DNA ligase I
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
dfa  Cavenderia fasciculata (cellular slime mold)
Pathway
dfa03030  DNA replication
dfa03410  Base excision repair
dfa03420  Nucleotide excision repair
dfa03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:dfa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    DFA_07246 (lig1)
   03410 Base excision repair
    DFA_07246 (lig1)
   03420 Nucleotide excision repair
    DFA_07246 (lig1)
   03430 Mismatch repair
    DFA_07246 (lig1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:dfa03032]
    DFA_07246 (lig1)
   03400 DNA repair and recombination proteins [BR:dfa03400]
    DFA_07246 (lig1)
Enzymes [BR:dfa01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     DFA_07246 (lig1)
    6.5.1.6  DNA ligase (ATP or NAD+)
     DFA_07246 (lig1)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     DFA_07246 (lig1)
DNA replication proteins [BR:dfa03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   Other elongation factors
    DFA_07246 (lig1)
 Prokaryotic type
   Elongation factors (archaeal)
    Other elongation factors
     DFA_07246 (lig1)
DNA repair and recombination proteins [BR:dfa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DFA_07246 (lig1)
   NER (nucleotide excision repair)
    Other NER factors
     DFA_07246 (lig1)
   MMR (mismatch excision repair)
    Other MMR factors
     DFA_07246 (lig1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C DNA_ligase_OB_2
Motif
Other DBs
NCBI-GeneID: 14872463
NCBI-ProteinID: XP_004367109
UniProt: F4PVW2
LinkDB All DBs
Position
Unknown
AA seq 929 aa AA seqDB search
MQSSMLSFLTKKTDSTSASQTSPKKQQQTSTTSKDDDKKKSSTTNNNNDKSSKLKRKNRD
DEQVEEEEEEDNDIFDLSDDDHKVASQVSSSSSSNFEEKSISPPTPTPTKPKKAAPKKPA
KSTTKKTKKMEEDPKKNNNNNNSTIPAVGTNNNNTMSDSQESSASSTPIKSTSPIKQTTS
PTKKDNLIPTVTVLPTKKNLETTTSTTSTTSTTTTKSNDENEILEEEEELEEEEDEEEVI
EEEFEEEEENEKGETVVLKKKIFVKKPVKQKSTAKQLEQELTNLSKYHPITDAQWKKGLP
VPYMALAKTFELIEGTSRRLLIIEHLTNLFRSIMALTPGDLINTIYMSINKIGPSYGGKE
LGIGESILMKAVAESTGRTMEFIKQELKTVGDLGIIAQSSRMTQTMMFAPPPLTIQGVFK
IFSQIADMTGNSSQNKKKDLITKLLVSCKESEALYIIRSLQGKLRIGLAERSVLIALTRA
MVISPPALIASEPNGKLDTRKGKTTEEFASVIDAAVAKVTRAYSQLPNYDLLVPRLIVAD
GVDTILETCRLMAGIPVKPMLAQPTTGITQVLDRFQEMEFTCEFKYDGERAQIHLTEDGK
ISIYTRNLEDYTGKYPDIIANVKRFIGEGVTSFILDCEAVAYDPTNNKILSFQILSSRPR
KGVSLDQIKIPVCVFAFDLLYLNGKSLIDEPFYKRREVLYANFKETPGALTYAKHANISD
VNDIQLYLQEAIDGNCEGLMVKTLKEQSIYEPSKRSYNWLKIKKDYMAGMTDSVDVVPIG
AWYGKGKRTGVYGAYLLACYDDDNEDFQTLCKIGTGFSDEQLKEFTEILAPQVTNSCKNT
YIVSDNLKPDVWFNPSQVWEVLAADLSISPIHTAAVGVLDPNKGIALRFPRFIQIRKDKN
PEDATTASQIVDMYKNQKINSFKMVDEDY
NT seq 2790 nt NT seq  +upstreamnt  +downstreamnt
atgcaaagctcaatgttatcattcttgacaaagaagactgattctacatcagcttcacaa
acttcaccaaagaaacaacaacaaacgagtacgacaagtaaagatgatgataagaagaaa
tcatcaacaaccaataataataatgataagagtagtaaactaaaaagaaagaatagggat
gatgaacaagtagaagaagaggaagaggaagacaatgatatctttgatttgagtgatgac
gatcataaagttgcaagccaagtctcttcttcctcttcttcaaatttcgaggaaaagtcg
atttcaccaccaactccaacaccaaccaaaccaaagaaagctgctcctaaaaagcctgca
aaatcaacaacaaagaagactaaaaagatggaagaagatccaaagaaaaataataataat
aataattccactattcctgctgtcggcactaataataataatacaatgagtgattcacaa
gaatcatctgcttcatcaacaccaattaaatcaacctcaccaattaaacaaacaacttca
ccaaccaagaaagacaacttaattccaactgttacagttttaccaaccaaaaaaaatctg
gaaaccactacttcaacaacttcaactacctctacaacaacaacaaaatcaaacgatgaa
aatgaaattttagaagaagaagaagaattagaggaagaagaggatgaggaagaagtaatt
gaagaagaatttgaagaagaagaagagaatgaaaaaggtgaaactgtagttttaaaaaag
aaaatatttgtaaagaaaccagtcaaacaaaaatcaactgccaaacaattggaacaagaa
ttaactaatctttcaaaatatcatccaatcactgatgcacaatggaaaaagggattacca
gtaccatatatggcattagcaaaaacctttgaattaattgaaggaacatcacgtagactt
ttaatcattgaacatttaaccaatttatttagatcgattatggcattgacaccaggtgat
ttgatcaataccatttatatgtcaatcaacaagattggtccatcgtatggtggcaaggag
ttgggcattggagaatcgattttgatgaaggccgtcgctgaaagtacaggtcgtacaatg
gaatttatcaaacaggagttaaagacggttggtgatttgggtatcattgcgcaatcgagt
agaatgacccagacaatgatgtttgcaccaccaccactcaccatccaaggtgtattcaag
atattctcgcagattgccgacatgactggcaactcttcacaaaacaaaaaaaaggatctt
ataacaaagttgttggtcagttgcaaagagagtgaagcactctacattatccgttcgttg
cagggtaaactacgtattgggttggcagagcgatcagtgttgattgcgttgactcgtgcc
atggtcatctcgccacctgcactcattgcatcggaacccaatggcaagttggacactaga
aagggtaagactaccgaggagtttgcaagtgtgatagacgcggctgttgccaaggtcaca
cgtgcgtacagtcagttacccaattatgacctgctcgtacctcgattgatagtggccgat
ggtgttgacacgatcctcgagacgtgtcggttgatggctggtatccccgtcaagccaatg
ttggcacagccaacaaccggtatcacccaagtattggaccgattccaagagatggagttt
acctgcgagttcaagtatgatggtgaacgcgcacaaatccatctcaccgaagacggtaaa
atcagcatctacacacgtaacctcgaagactatactggcaagtaccccgatatcatcgcc
aacgtcaagcgattcattggagagggtgtcacctcttttatcctggattgcgaggctgtt
gcgtacgaccctaccaacaacaagattctctcgttccaaatcctctcttcgagacctcga
aagggtgtttcgttggatcaaattaagattccagtctgtgtatttgcctttgacttgctc
tacctcaacggaaagagtttgattgacgagccattctacaagcgtcgtgaagtgctctat
gccaactttaaagagacgcccggtgccctcacctacgccaaacacgccaacatctcagat
gtcaacgatatccagctgtacttgcaagaagccatcgacggcaactgcgaaggtttgatg
gtcaaaactctcaaggagcagtccatctatgaaccatccaagcgttcgtacaactggctc
aagatcaaaaaggattacatggcaggcatgacagactcggtcgacgttgttcccattggt
gcatggtacggaaagggtaagcgtactggtgtctatggtgcctatttattggcatgctat
gacgatgacaatgaagatttccaaactctttgcaagattggtactgggtttagtgatgaa
caactgaaagaatttactgagatcctcgcaccacaagtcaccaatagttgtaaaaacacc
tatatcgtatctgacaatttaaaaccagatgtttggttcaatccatctcaggtctgggaa
gtattggccgccgatctctccatctctcccattcacactgctgccgtcggtgtgttggat
cccaacaagggcatagctcttcgtttcccaagatttattcaaattcgtaaagataagaat
ccagaagatgcaaccaccgcctctcaaatcgttgatatgtataaaaatcaaaaaatcaat
agttttaaaatggttgatgaagattattaa

DBGET integrated database retrieval system