KEGG   Cavenderia fasciculata (cellular slime mold): DFA_09851Help
Entry
DFA_09851         CDS       T02668                                 

Definition
(RefSeq) hypothetical protein
  KO
K10691  E3 ubiquitin-protein ligase UBR4 [EC:2.3.2.27]
Organism
dfa  Cavenderia fasciculata (cellular slime mold)
Brite
KEGG Orthology (KO) [BR:dfa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:dfa04121]
    DFA_09851
Enzymes [BR:dfa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     DFA_09851
Ubiquitin system [BR:dfa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   UBR box proteins
    DFA_09851
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: E3_UbLigase_R4 ZZ DUF4125
Motif
Other DBs
NCBI-GeneID: 14867418
NCBI-ProteinID: XP_004351748
UniProt: F4QAW9
LinkDB All DBs
Position
Unknown
AA seq 5425 aa AA seqDB search
MSDVDPDLLLAIALSESLMVLGKGGDESTKNDDQEDDENNPNDNNNNKENNDDPPPQIAS
DSQKDRIYDYFVELVGQLKNDKIGNLTPLLCVLKDLVLLPQHIHYVTKVLELISFLIIDG
KYGDMDVQKIYSFSKVTVEFCLSTLERWSENELDIDGNLVGSSTNMTSSTGTATATTITI
KLSTPLILLSIIDMLCCIEFPSTSIDKSQLDKIPSFLNVTNLDRFVGVTESKESTSESKP
TIVTEAVVVSTTSSPSPLPTSSTIELFNQFLNNGIGKESTPLISSSSVVDSGGAVNISSS
LILDHDQLNEEILKSNTTYFNKNLRGASRLLAICSKLLPAYQTEMEVSEKFESFLARENL
IYNFLSNVQDILFSEGFEQLDAASIPWTIDFIARLIGTFRSYQAYNLKALSVYEQQKETE
QKLQDGGGEQQQSTAKTTVPSPLIKSKLLSSQVFENLFQVLGTKLNCPDLQIKAEIFFSL
CILNDIEKMNIKIQDIMVKDSLVEKDYITWSPQLVILAISLIFDRLESMNNISDSGSINR
VISPIMISDLPSTFGSAKPHTKFLHVSALDKQLIWFDYLSPKQYTAAELTSMFITPRLLD
NILSILYISYFKLKDSQHSALSVTDSPSSTTSTPFTTPIKSGGSSTSVPVAPTKATAASL
NESSDEGISMFGSLFESGPSLGMSTTAPPTSTTTTTTATTSNTNEFDIQLEGSYQSFINF
VNVTFAKPAVVSKLFSFLNDVHLQVLSTILLYQSPHGSSYSPYIQSQAIANILRSINLNI
IKSLDVLSVPLQEKWIDSIFDLCNRTIDQEKEKKTTTEVEALAIGSISPPRELLSLLGWI
FVKRQQLKLTSSTNTTTTASDDKIIMTLWERFIYFNNVQNNQFVSVPKEMIIGFEYITFL
LFSFHSLNEQNRLAILQKSVDIIHQIIEKRKSDQSYLPNSLIFSRFLFIFNYIIFNFDKM
ETKISKLFYESVLTLNQTNSTKDLPLSLVTVNYKHIIDQIKQSSSSSTLSSIPVFYEFNF
NSTSSGGLSSFSTSHLQQCTDLFNRCSVVYQDFYRDVVSLCIMKIESQGQPIESLLFDYI
ITSACSLLRSLPPSNSFIQMIKDPSLFINISNETIIYLTYLHSILVHHETNKDSLIDIPW
NIHTNNIIKLLQSNNNNNIRLNSLLQSILSYLIVIFDQQQQQSSSSSSSKNALGESGSDY
MEGWESLFDDDDDEEDDSSDNEDNSDGMDSSDSDEKEKDEGNPSSASSSQQENKESGLAG
INKQALLDMLPILYPSIVSVIKSVKSLYENELLSLIKTPSVMENDKILLAREVFSHVSEK
SDAMQLIDLLGVSKEDRDAIEKYWGVEVKIDLTSIPKHQRCSMSWILHPALIYSDKTLTV
LSNQMLLRSLSELSDLITKMDDSNKESSGSATTTATTTTASTTVVDSPMIIDSNQEDKKL
VESYRLELSYTRADISTDQLLLFSKESQYLDIDSQSLLYIVSMSQISSFERVCQLLSKQS
LEVRSAPVTERIINYHLDHMTVITKSYPSYFYCHYIPAYRKLVSPMGDKFRVELPQGDIS
QLLNFTIESEKVDKKSLGVLIQIMSLPVPQQSIVGGGAKLESLRSFAIRSILKDIPQEQL
SKWFQEKLLGYVKQDDSAAAASSSDAMQVDVKQKLVPSTIEIQELIVKFIGILTGSNELA
GYTKEQPGSNDKQPKESAASPSSTSSDSSSDEEEEENERLKKKKAWAKKTAFVSPPASSS
PAVGNVSAAAASLIDWEEKVENISPLIYNILLGCFESAFTDWIDYPSLLKGYFGLLQYVA
MKQHKLVDLFEQVSHLSANVLVNPTPSQLESLNLIVEFIENILKILRGDLDEDSMDTKTE
QQHHHCHHTSANSDQKQTTDQEMGDVGNNLLLDDEEEVDDDEDSKWKASNSESSGSGADQ
ADNEEDEARKLASKLCTYSQTKNDYMDQHWYFCYTCNLKTSEGCCSTCVKVCHKGHVVSY
SRFSRFFCDCGAGAGKGGPCKALKPRVYQPEKKKPATAEQPSSVPISQPVVAATSPATTT
AIVSPSVVTSSSSSSPSSIFDGELSQEEKKKIIEEITEQKVPVIEKIAELYPKLVQALKS
SSEKAVTPTNINTVDVYAVPKKELVVRTDLVVPKKSTKAGVFDSKTKYEGGSEGSQLKNL
VNAGLIQKRALASNSRGVVAVAEGENVSLVNVAKLVDEEANTVDRAALKTLSKSAIGFPV
MSMVFNPTNDNFLAVVGARECKILTINNKDEIVDQLVIDLSLYSIGENIYIIKVDWVVGS
QVELAVATNEFVKIYDLSTDNLSPTHFYTLVEDSIRDTAIIKKGAQLHLLALAESGMLYS
QPIQPSIDDESCIMIETVQLPIVKQSPGVCLFSAPDIPGIFVTFTNGEAYMVNLDDSATT
VVTAVTIQDVNLKVAMPSCYFMTLAPAYPTVVTALAARGGFMVSLKMTSTAEMHVQAIKM
SSKVDGMTWVNKASPKMLVLFEDGTLTRYDYTIDSPLTLSSSISSASSPQNAIGGSQLSS
GSGIDILSIISKQKQIKSSDEPAKNVATTTTTAAVPTSPSTSVQKKPIVSFPIDYFEKVD
CITKNIKFGGDPLQSYSQDVIKQRLSNTDEYVVCQGQDTMTIIIYNNNPEVVICGIGVLV
GNASTKHVPSELRVFDRTITCTDGMRRWYDIPLTNEEAIKSAKKLTLFVGPNASNSPIID
SIEVYGTPKDVIGYDEAVELGSKSSAANSIDSLNTTEMVLLRTLSCLGLYFVNCSDEATR
DNAVYKSLKEKTTKQLASFMTDPQLSFLHPIVKDLLKILLPNEEEYLSLRHSTLLNHCSE
TISKMVGGVSTGDFAENLEHIILILKKISCTRPNNLTTQIFSTKPTFLADLINVHRQATS
GGSGLNGSLVSEEVITNLTHLLWNCLTSRAFSSDYILGLVKNLLSHPQESIRVRSSIALV
SLISKSNLKSSIKPIVPAKSSVVATTTSATATAADLIDEVHFSCDKCSVYPIQQKRYHCE
VCGDFDLCSDCYLKITATKEHPQDHLIKEYLLDETMTDDSSSNKQVAEPSLQEGTFDEDL
NAAIAMSLDASQHPDQKLVNEEDPFDNMFRFLLDELFAVLDKGFNYALPYAQVVYTLFVH
IGTDLKADTFTRFSTLIMKQLTESHSNFEKYLTGKSLSLEGDSVIIILLSLLLDTDIHKQ
QHSKSSNKPSSSSSNSSVINVNQLVLPQTSIYAISENMESQGFMDKVLRYWLDHLYQVIS
SQVNYNSPETNAMSSPFGALLISSHSEDQSLPKSRFAPFFSKSLPSSPQSLQQSITKHLF
KLAITFYRCDRHHRKANPSINWFTPTADWMSLTCSYIHSKKTTQFVKYPKKLLLLLATTK
ESYYAVRDEFLLKKKYSKIQALERQYNGFTDDIHYDHLIKLIGYLSSMLEVASTRPHSWQ
YFCTNNDILNGLFNNLFFLPEETSQLILELLTFAFVTEEQSSSSSSSLSSLPSTTKNDTI
MQDSEKVTMFLQGDSLDILINNLLLEPNASDLRQNTSNFIYNLWKASDIDQKVHINKCLW
SKLDQVVSYGKNSNEFMELLTYVINGIDPNKWKDQYNEFADKFIESFKLQNQCVHNHPNS
QIYTSLGSILELDGYYLESEPCLVCNNPETQFQTVRIDSLKQEYKFTDSCHLIKFNGVYS
IQKLQINIHDSKKARMIKTINLFYNNKTTSDIGELKGKFAQWKKLKQIHFAPNQTEKTIR
FQIPIAATNFMIEYFDFHDNLQVLASEKLQCPRCSRTVTDKHGICKHCHENAFQCKQCRN
INYENLEGFLCNECGFCKHARFDYQFTCKPTVSIEKIENQDDHKRAISTIDKESENAHKK
YQRLIGFKRIISNLITSYQTQEPWPKEELFNQLGISVAASASSPPNAAASGAGGATTSAS
NPNSIPSLRINRKIGYLARLYEKECKSIFESLSKSVQILLNTRMEIIKYMNVLAKKPRSK
EIKSRSSNNCFGCSNAYTEQSLSFLNHLSRNPQLVDLRNMLIQKGLTKELFMNNIYHGKS
DSRNNARLAISYLTKNNLTATTELNGWISEKIFYAIENHTSLDLSTMISSEMFLLRDCTA
LTDNIWQTRFRFIMEIFFKSIEAGSNNPIISEYITLPCLKIILSLCTLERNTTDLLQKDL
NDTEDHQKTLRLKFEKLRSLIKLKEQQIQLQQQQQQGGQLSSSASSVVVNSPPPPPPSAA
EVQEPAATKEKVISTSGNGWNYFDQSESSVKFDEFLASDTFDQWANKYQSSIFNNTTPTT
SPTTATAATTTTTTVVDKVEIRNRYLTSKYLAKWKKQVKKSAAATSNTNPLEGIFLEDGW
VSKLLFNSTPSIRSETISLMNILSRSSQVRTYKFLDLFVKLIPHACKVGENSAEFFSLFG
KIISSDERKIYLTVRGFLPYLCDLIILDIDRINSLETSFNTDFSQGYVLKTLVNILMSFV
DVSSIKLKMKRDNLIEKVLDAFLSLRGVIIQKNKLTEDAVKQLQELMKSLNTESVEDNKK
FMAANVKALTKHSKNGRTPIFIFEQLCNIVCPVKPEPVYQLVLIKSSTQEEYIRGSMKNP
YASNTVGSLMRDIKNKICKTLDLGTFLEDDNGMELLVDNKIIKLDLPIKRVYEQVWKRSA
VAQRSQDINTPMTVVYRLQGLDGEATEENIENLNDDNGEEKDPEVEFEITSIFSQCGGLE
AMLTIVDDIADFSSEKELAHLVIKLLFHSCKIKVNREQLITHNGIGRLLEKLKTAFHQPD
LAETLLLIIESIVTEANRSYLTNSNSSTSQITTNDQHHKDTNEAQEQMTMFLDKLASPLV
RNNTRIIQAMTRIIPFLTYGHSGVINSLIDFFQPYLNFDEYDAGKKTDPNVTAHVDFFTK
IADFTRPDENGSKLRQLVLERGITKQLYEYIDKNLPSDKDKSSPEWIGSLERAALPYVLV
LLKGLANGHEPTQLMSVNEFNVLKRLHLMEQTSTTSTKNVGSLAENFLESLQVNNKKMAD
EIHNIRTESKREKLAQAEKHRENVLKELGLSQQGKHITANVVPTIIEDLEDEEGFTCMVC
REGYNFKPDDVLGIYTYSKRVALHALNETTATPSSSGQSERRESSGGNAHCYTTVTHFNI
IHYYCHRDATKADKSMKVPKEEWEGAALRNQQTKCNNIFPIQGPKITNDAFTPFCDKYWT
NLNNVGRIDGSNPRFRLLAHDLKLLFLRFAKDESFSTDSKGGGKDSNIRIVPFFIQFGNF
LLDQKIVGNQANQVRRPHFDKLFNQFVGLSLESSINNCTIEVDNVPYYLVLSLYLQSLKD
WKSSRLNFLSKLIAYAFSEKQPANKTKFAILRPWLLFFTMIDKFHEIIHPPIKPEASSIT
SPTTSTTTVLEPWIIDTKTNLASHYLKIQQDCKSFLSSFEEEYSVFEEESEFFDDLGLLK
EILALDSKDSNTYINNIEQLVKQKK
NT seq 16278 nt NT seq  +upstreamnt  +downstreamnt
atgagtgatgttgatccagaccttttattagctattgctctctctgagagtttaatggta
cttggtaaaggtggagatgaatcaacaaaaaatgatgatcaagaggatgatgaaaataat
ccaaatgataacaacaacaacaaggaaaataatgatgatcctccaccacagatcgctagc
gattcacaaaaagatagaatctatgattactttgttgaattggttggtcaactaaagaat
gacaagattggcaacttgactccacttctttgtgtactcaaagatcttgttttacttcca
caacatattcattatgtaaccaaggttttggaattgatatctttccttattatcgatgga
aaatatggggatatggatgttcaaaagatttattcatttagcaaggtgactgtagagttt
tgtttatcgacacttgagagatggagtgagaacgagttggatattgatggtaatttggtt
ggatcgtcgacgaatatgacctcttcaactggaacggcaacggcgaccactatcaccatc
aagttatcaacaccattgattttattatccatcattgatatgctttgttgcatagaattc
ccatccacctctatcgacaagtcacagttggacaagatcccatcattcctcaatgtcacc
aatttagatcgttttgttggtgtcacagagtctaaagaatcaacaagtgaaagtaaacca
acaattgtaactgaagctgttgttgtttctactacatcatccccttctcctttacctact
tcatcaacaatagaattatttaatcaatttttaaataatggtattggaaaggaatcaaca
ccattgatatcatcatcttctgttgttgatagtggtggtgctgtaaatatatcatcttca
ttgatccttgatcacgatcaattaaacgaagagattctaaagagcaatactacctacttt
aataagaacctaagaggcgcctctcggttgttggccatttgctccaagctccttccggcc
taccaaaccgagatggaggtttccgaaaaatttgaatcattccttgcaagagagaattta
atctacaactttctaagcaacgttcaggatattctattttccgaaggttttgaacaactt
gatgctgcatcgattccatggacaatcgactttattgctcgattaattggtacttttaga
tcatatcaagcttataatcttaaagcattgtctgtttatgaacaacaaaaagaaaccgaa
caaaaactacaagatggtggaggagaacagcagcagtcgactgccaaaacaaccgttcca
tcacctcttattaaatcaaaattattatcaagtcaagtatttgaaaatttatttcaagtt
ttgggtacaaaattaaattgtcctgatcttcaaattaaagctgaaatattcttttcactt
tgtattttaaatgatattgaaaaaatgaatattaaaattcaagatataatggtaaaggat
agtttagttgaaaaggattatattacttggagtccacaattggtgatattggccatatca
ttgatttttgatcgattagaatcaatgaataatatttcagattctggaagtatcaacagg
gtgatatcaccaattatgattagcgatctgccatcgacctttggcagtgccaagccacac
actaaattccttcacgtttcggcattggataagcaactcatttggtttgactatctctca
cccaagcagtacactgctgccgagttgacctctatgtttattacacctcgactcttggac
aatattctttcaattctttatatttcctatttcaagttgaaggattctcaacattctgcc
ttgtcagtgactgactcaccatcgtccactacttctactccttttactacgcccattaaa
tcgggtggatcctctacttctgtaccagttgctccgaccaaggctacagctgcatcactt
aatgaatcatcagatgaaggaatatcaatgtttggatcattgtttgaatctggtccttct
cttggcatgtcaaccacagctcctccaacatctacaacaacaacaacaacagctaccacc
tctaatacaaatgaatttgatattcaattggaaggtagttatcaatcatttatcaatttt
gtaaacgtaacctttgccaaaccggctgtagtatccaaacttttttcattcctcaacgat
gtacatttgcaagtcttgtcgaccatccttctctaccagtcaccacatggaagttcctac
tctccatacatccaatcccaagccatcgccaatatcttgcgttccatcaacctcaacatt
atcaaatctttggatgtcttgtccgtcccattacaagagaaatggatagattccattttt
gatttatgtaatcgtacaatagatcaagaaaaggaaaaaaagactacaacagaggtagaa
gcattggctattggatcaatatcaccaccacgtgaattattgtcattattaggttggata
tttgtaaagcgtcaacaattaaaattaacatcctccaccaatactaccacaactgcttct
gatgacaaaattataatgacattgtgggaaagatttatttatttcaacaatgtacaaaat
aatcaatttgtcagtgtgccaaaggaaatgatcattggttttgaatacattaccttttta
ttgttttcattccatagtttgaatgaacaaaatagattggcaatcttgcaaaaatctgta
gatatcattcatcaaattattgaaaagagaaaatctgatcaatcctatcttccaaattct
ttaattttctctagatttttatttatctttaattatataatatttaattttgataaaatg
gaaacaaaaattagtaaattattttatgaatcagtgttgacattgaatcaaaccaattca
accaaagatttaccattgtcacttgtaacagtcaactataaacatattatcgatcagatc
aaacaatcgtcatcgtcatcgacattatcttccatcccagtattctatgaattcaatttc
aatagtacaagtagtggaggattgtcatcattttctacttcacatcttcaacaatgtacc
gatttattcaaccgttgctcagttgtctatcaagacttttatagagatgttgtatcatta
tgtattatgaaaatagaatcgcaaggtcaacctatagaatcactccttttcgattatata
attacctctgcttgttctctattacgttcacttcctccttcaaattcatttattcaaatg
attaaagatccttctttatttattaatatatcaaatgaaacaattatttatttgacttat
ttacattcaatattggttcatcatgaaacaaataaggatagtttaattgatataccttgg
aatattcatacaaataatattataaaattattacaatctaataataataataatattaga
ttaaatagtttattacaaagtatattatcatatttgattgttatatttgatcaacaacaa
caacaatcaagttcttcatcttcgtcaaagaatgcacttggagaatcaggttccgattat
atggaaggttgggaatcattgtttgatgatgacgatgatgaagaagatgattcatcagat
aatgaagacaattcagatggaatggattcttcagattcagatgaaaaggaaaaggatgaa
ggaaatccttcatctgcatcatcttcacaacaagaaaacaaggaatctggattggctggt
atcaacaaacaagctttattggatatgttgcccattttatatccatctatagtcagtgtc
ataaagtctgttaaatcactctatgaaaatgaattgctttcattgataaagactccatcg
gtaatggagaatgacaagatcctattggctagagaagtcttttcacacgtcagtgaaaag
tcagatgccatgcagttgatcgatttgttgggtgtatccaaagaagaccgtgacgcaata
gaaaagtattggggtgttgaagtcaagatcgacttgacatccattccaaaacaccagaga
tgttcaatgagttggatcttacatccagctctcatctactctgacaagactcttacagta
ctctccaaccaaatgttgttgagatcattgtctgaattgtctgatctaatcacaaaaatg
gatgatagtaacaaggaaagtagtggatctgctacaactacagctactacaacaacagct
tcaacaacagttgtagattccccaatgattattgatagtaatcaagaagacaagaaattg
gttgaatcttatcgtttggaattatcatatacacgtgccgatatttcaacagaccaattg
ctactctttagcaaggagagtcaatacttggatatcgattcacaaagcttgttgtatatt
gttagcatgtcacaaatctcttcgtttgaacgtgtttgtcaattactctccaagcagagt
ttagaggttcgttcagcgcccgtcactgaacgtatcatcaactaccatctcgatcacatg
acagtcatcaccaagagttatccatcctacttttattgtcactatatcccagcttaccgc
aagttggtgtctcccatgggtgacaagtttagagtagagttgccacaaggtgacattagt
cagttgttaaactttaccattgaaagtgaaaaggttgacaagaaatcacttggtgtattg
atccaaatcatgtcattgccagtaccacaacaaagtattgttggcggtggagcgaaactc
gagtcactcagatcgtttgccattcgttccatcctcaaagacattccacaagaacaattg
tcaaaatggttccaagagaaattgttgggttatgtcaagcaagatgattccgctgctgct
gcttcatcttctgatgccatgcaagttgatgtcaagcagaaattggttccatcaaccatc
gagattcaagaattgattgtcaaatttatcggtatcttgactggaagtaacgaattggct
ggttacaccaaggaacaaccaggtagcaacgacaaacaacccaaagagtcggcagcctca
cctagctcaacatcatcagactcgtcaagcgatgaagaagaggaggaaaatgaacgtctc
aaaaagaaaaaggcatgggccaaaaagactgcctttgtatctccacctgcatcatcatca
ccagccgttggaaatgtttcagctgctgctgcatcattaatcgattgggaagaaaaggtt
gagaatattagtccattgatttacaatattctccttggatgctttgaatctgcatttacc
gattggatagactacccatcactactcaaaggatactttggattgttacaatacgttgca
atgaaacaacacaaactagtcgatttgtttgaacaagtttctcacctctctgccaacgtt
cttgtcaacccaactccatctcaactagagtcactcaacttgattgtagaatttattgaa
aacattttaaagattcttagaggtgacctcgacgaagattcaatggacaccaaaaccgaa
caacaacatcaccattgtcatcatactagtgcaaatagtgatcaaaaacaaacaactgat
caagagatgggagatgttggtaacaatttacttttagatgatgaagaagaggtagatgat
gacgaagattcaaagtggaaggcatccaacagtgaatcaagtggtagtggtgccgatcaa
gctgataatgaagaagatgaagctcgtaaacttgctagcaagctttgcacctactctcag
acaaagaatgattatatggatcaacattggtacttttgttacacttgcaatctaaagaca
tcagagggatgttgctcgacttgtgtcaaggtttgtcacaaaggccatgtcgtcagttat
agcagattcagtagattcttttgtgattgtggtgctggtgctggtaaaggtggtccatgt
aaagctctcaaaccacgtgtttaccaacctgaaaagaaaaagccagcaacagcagaacaa
ccatcttctgttccaatcagtcaaccagttgttgccgccacttctcctgctactactact
gctatagtctcaccttctgttgttacttcttcttcctcttcttcaccttcatcaattttt
gatggagaattaagtcaagaagaaaagaaaaagataattgaagagattacagaacaaaag
gtaccagtcattgaaaagattgctgaattgtaccccaagttggttcaagcactcaaatca
tcaagtgaaaaggcagttactccaaccaatatcaatactgtcgatgtctatgccgtacca
aagaaggaattggtggtccgcaccgacttggttgtaccaaaaaaatcaacaaaggcaggt
gtatttgattccaagaccaagtatgaaggtggaagcgagggtagccaactcaagaatctt
gtcaatgccggtttgatccaaaaacgtgcattggcatccaattcacgtggtgtggttgcc
gttgccgagggcgagaatgtgtctcttgtcaatgttgccaagttggtagatgaagaagcc
aacacagtcgacagagctgcactcaagacattgtcaaagtctgccattggtttcccagtc
atgagtatggtgtttaatccaaccaatgacaatttcctagctgtcgtaggtgctagagaa
tgcaagattttgactatcaacaacaaggatgaaatcgttgatcaattggtcattgacctt
tcactctattcaattggtgaaaacatctatatcatcaaggttgattgggtggttggatca
caagtagagttggcagttgctacaaacgaatttgtcaagatctatgacttgtccactgac
aacttgtcaccaacccacttttacacacttgttgaagactctatccgtgacactgccatc
atcaaaaagggtgctcagttgcatcttttggcacttgcagagtcgggtatgctgtatagt
caacccattcaaccttccatcgacgatgaatcgtgtatcatgattgaaacggttcagttg
ccgattgtcaagcagtcaccaggtgtctgtctctttagcgctcccgacataccaggtata
tttgtcacttttaccaatggcgaagcttatatggttaatttggatgattctgccaccaca
gtcgtcacggcagtcaccattcaagacgtcaacctcaaggttgccatgccatcatgctac
tttatgacattggcacctgcctatccaacagtggtcactgctctggctgctcgtggcgga
tttatggtgtcactcaagatgacttcgactgccgaaatgcacgtacaagctatcaagatg
tcgtccaaggtcgatggtatgacatgggtaaacaaggcgtctcccaagatgcttgttctc
tttgaggatggaacactcactagatatgactataccatagactctccattgacattgtca
tcatcaatctcttctgcatcatcgccacaaaatgcaatcggtggttcacaactatctagt
ggttcaggtattgacattttatcaatcatttcaaaacaaaaacaaatcaaatcatcagat
gaaccagccaaaaatgttgctactacgacaaccactgcagccgttcctacatctccttct
acttcagttcaaaagaaaccaatagtttcattcccaatagattattttgaaaaggttgat
tgtataacaaagaatatcaagtttggaggtgatccattacaatcctactcacaagatgtc
atcaagcagagattatcaaacactgatgaatatgtagtttgtcagggacaagataccatg
accatcattatctacaataataacccagaggttgtgatttgtggtattggtgtgttggtt
ggaaatgcttcgaccaagcacgttccatcagagttgcgtgtatttgatcgtacgatcacg
tgtacagatggtatgcgtcgttggtacgacattccacttacaaacgaggaggctataaag
tcggccaagaaactcaccttgtttgtaggaccaaacgccagcaactcgcccatcattgac
tcgatcgaagtatatggtactcccaaggatgtgattggatatgatgaagcagttgaactc
ggatcaaagtcgagtgccgccaattcaatcgattcactcaacacaacggaaatggtgttg
cttcgcactctttcttgtcttggattgtactttgtcaattgcagtgacgaggcaactcgc
gacaatgcagtgtacaaatcactcaaggaaaagacaaccaaacagttggcatcgtttatg
actgacccacaactatcgttcctccaccccatcgtcaaggatcttctcaagatactcttg
cccaacgaagaagagtatctctcactgcgtcactctactctactcaaccactgctctgaa
accatctcaaagatggtcggcggtgtttcaaccggtgactttgccgagaatctcgagcac
atcattctcattctcaaaaagattagttgcactcgtcccaacaacttgaccacacaaatc
ttttccaccaaaccaacgttccttgccgacctgatcaatgtgcatcgtcaagctaccagt
ggtggaagcggtctaaacggcagcctagtctctgaggaagtcatcacaaacctcacccat
ttgctttggaattgtctcactagtcgtgcattctctagtgattacatcctcggtcttgtc
aaaaacctattgtctcatccacaagaatcgattcgtgttcgttcctctattgcattggtc
tctttaatttcaaaatcaaatttgaaatcttctatcaaacctatcgtcccagctaaatca
tctgttgttgcgacgactacatcagctacagctacagcagccgatctaattgatgaagta
cacttttcatgtgataaatgctcggtttatccaatccaacaaaagagatatcattgtgaa
gtatgtggagattttgatctttgtagtgactgttacctcaaaattacagccaccaaagag
cacccacaagatcatcttatcaaggaatacctattagacgagacaatgaccgacgacagt
agcagcaacaaacaagtcgcagagccttctttacaagaaggtacctttgatgaagatcta
aatgcagcaattgcaatgagtttggatgcctctcaacacccagaccaaaaactagtcaat
gaagaggatccatttgacaatatgtttagattcttgttggacgagttgtttgcagtgttg
gacaagggtttcaactatgcattaccatatgcccaagtagtatacacactctttgttcac
attggaaccgatctaaaggccgatacatttaccagattctcaacactcatcatgaagcaa
ttgacagaatcccattcaaactttgaaaagtatctcactggtaaatcattgtctttagaa
ggtgactctgtcattattatcctattatcattattattggataccgatattcataaacaa
caacattctaaatcttcaaacaaaccatcatcatcatcatcgaacagttctgttatcaat
gtcaatcaattggtattaccacaaacttcaatctatgcaatcagtgaaaacatggaatca
caaggatttatggacaaggttcttagatattggttggaccatttgtaccaagtcatttct
agtcaagtcaattataatagtccagagaccaacgccatgtcaagtccatttggtgcattg
ttgattagtagtcactctgaagaccaatcactccccaagagtagatttgctccattcttt
tcaaagtcactcccatcgtcaccccaatcgttgcaacaatccatcactaaacatctcttt
aaacttgccatcactttctacagatgtgatcgtcaccaccgaaaggccaacccatccatc
aactggttcaccccaaccgctgattggatgtcactcacttgttcgtacattcactctaaa
aagacaactcaatttgtaaagtatccaaagaaattgcttctcttacttgctaccaccaaa
gaatcctattatgccgttcgtgatgaattccttctcaaaaagaaatattcaaagattcaa
gcactcgaacgtcaatacaatggtttcactgatgatattcattatgatcatcttatcaaa
cttattggttatttatcttcaatgttggaagttgcttcaacaagacctcatagttggcaa
tatttttgtacaaataatgatatattaaatggattatttaataatttattctttttacca
gaggaaacatctcaattaattttagaattattgacatttgcttttgttactgaagaacaa
tcgtcatcttcttcttcttctttgtcttctttaccttctactacaaagaatgatacaatt
atgcaagattcagaaaaggttacaatgtttttgcaaggtgattcattggatattttaatt
aataatttattattggaaccaaatgcatcagacctacgtcaaaacactagtaactttatt
tataatctttggaaagcatcagacattgatcaaaaggttcacattaacaaatgtttgtgg
agtaaattggatcaagtcgtttcctatggtaaaaattcaaatgaatttatggaactttta
acttatgtaattaatggtattgatccaaataaatggaaagatcaatataatgaatttgct
gataaatttattgaatcatttaaattacaaaatcaatgtgtacataatcatccaaattca
cagatttatacaagtttgggatctattttggaattggatggatattatttagaatctgaa
ccatgtcttgtatgcaataacccagagacacaattccaaacggttcgcattgatagtttg
aaacaagagtacaaatttaccgatagttgtcatttgatcaagtttaatggagtctatagc
attcaaaaactacaaatcaacattcacgattctaaaaaggccagaatgatcaagaccatc
aacctcttttacaacaacaagaccacatcggatattggtgaattaaagggcaagtttgct
cagtggaaaaagttaaagcaaatccactttgcaccaaaccaaacggaaaagaccatcaga
ttccaaatcccgattgccgccaccaactttatgatcgagtattttgactttcacgacaat
ctccaagtacttgctagtgaaaagttgcaatgcccacgctgttcgagaaccgtcactgac
aagcatggcatctgcaagcattgccacgagaatgccttccaatgcaagcaatgtcgcaac
atcaactatgagaacctcgaaggtttcctctgtaacgagtgtggtttctgcaaacacgct
cgctttgactaccagtttacatgcaaaccaacagtgtcgattgaaaagatcgagaaccag
gacgaccacaaacgcgctatctcaaccattgacaaggagtctgaaaatgctcacaaaaag
tatcaacgtttgattggcttcaagagaatcattagcaacttgatcacatcctatcaaaca
caggaaccatggcccaaggaagagctctttaatcaacttggcatttcagttgctgcatct
gcttcatcgccaccaaacgcagccgcaagtggcgccggcggtgcaaccaccagtgcttcg
aatccaaattcaatcccatcgcttcgtatcaaccgaaagattgggtatttggcacgtctc
tatgaaaaagagtgcaagagtatctttgaaagtctcagcaagagtgtacagatcctattg
aatacacgtatggagattatcaaatacatgaatgtattggccaagaaaccacgttccaaa
gagatcaagagtcgtagttccaacaattgttttggttgctccaacgcctacacggagcaa
tcactctcgttcttgaaccatctgtcacgtaatcctcagttggtcgatctccgcaacatg
ctcattcaaaagggactcacaaaagagctctttatgaacaacatctaccacggaaagagc
gattcgagaaataacgcccgtcttgccatctcttacctcaccaaaaacaacctaacggcc
actaccgagctcaacggatggatcagtgaaaagatattctatgctattgagaatcacacc
tctctcgacctatcgaccatgatatcgagtgaaatgttcttgttgcgtgattgtactgcc
ctgactgataatatctggcagacaagattccgtttcatcatggaaatctttttcaaatcg
attgaagctggatccaacaatccaatcatctctgaatacatcacattaccatgtctcaag
atcattctctccttgtgtacattggaaagaaacacaactgaccttttacaaaaggatctc
aatgatactgaagatcatcaaaagacacttcgtctaaagtttgaaaaattaagatcactc
atcaaattaaaagaacaacagattcaacttcagcaacaacaacaacaaggtggtcaatta
tcatcatcagcttcatcagttgttgttaattctccaccaccacctcctccatcagcagca
gaagttcaggaacccgctgccaccaaggaaaaagtaattagtacaagtggaaatggatgg
aattactttgatcaatcagaatcatctgtcaaatttgatgaattcttggcttcagataca
tttgatcaatgggcaaacaagtatcaatcatcaatctttaataatacaactccaaccact
tcacctactactgccactgcagctactaccaccactactactgtagttgacaaggtagag
attagaaaccgttatcttactagtaaatatttggccaaatggaaaaaacaagtaaagaaa
tctgcagctgctacctccaacaccaacccattggagggtattttcctcgaagatggatgg
gttagtaagttattgttcaattcgacaccatcaattcgtagcgaaaccatcagtttgatg
aacatcttgtctcgtagcagtcaagtacgtacctacaaattcctcgacctctttgtaaag
ttgattccacatgcttgcaaagttggagaaaactctgccgaattcttttcactctttggc
aagattatctcgtctgacgagagaaagatctatttgacagtccgcggattcttgccctac
ttgtgtgatctcatcatcctggatatcgatcgtatcaactcgctcgaaacctcattcaac
actgactttagtcaaggctatgtgttaaagacactcgtcaacattctcatgtcgtttgtc
gatgtctcgtcgatcaagctcaagatgaagcgtgacaacctcattgaaaaggtattggat
gcattcttgtcgcttcgtggtgtcattattcaaaagaacaagctcactgaagatgccgtc
aaacaattgcaagagttgatgaagtcgctcaacaccgagtcggttgaagacaacaaaaag
tttatggctgccaatgtcaaggcactcaccaaacactccaagaatggcagaacacccatc
tttatctttgagcagttgtgcaacattgtgtgtcccgtcaagcccgagccagtctaccag
ctcgtcttgatcaaatcatcgacacaagaggaatacattcgtggctctatgaagaatcca
tacgccagcaacactgtcggttctctgatgagagacattaaaaacaagatttgcaagacc
ctcgatcttggcacctttttggaagacgacaatggcatggaattgcttgtagacaataag
atcatcaagctcgatctacccatcaagcgtgtctatgagcaagtgtggaagcgaagcgcc
gttgcccaacgttcgcaagacatcaacacgccaatgaccgtcgtctaccgtctccaaggt
ctcgacggtgaagccaccgaagaaaacattgaaaacctaaacgatgacaatggcgaagaa
aaggatccagaggttgagtttgaaatcaccagtatcttttcgcagtgtggcggtctagag
gccatgctgacaattgtcgatgacattgccgacttttcatccgaaaaggagttggcacac
ctcgtcatcaagctgttgttccatagttgcaagatcaaggttaaccgcgagcaactcatc
acacacaatggaattggacgtttgcttgagaaactcaaaacagcgttccatcaacctgat
ctcgctgaaacgctgcttttgattatcgagtcgatcgttacagaagccaaccgcagctac
ttgaccaacagcaactcgtctaccagccagatcaccaccaacgaccagcatcacaaggac
acaaacgaagcacaagagcagatgaccatgttcctcgacaagttggccagtccgttggta
cgcaacaacacacgtatcatccaggccatgacccgtatcattccattcttgacctatggc
cattcgggtgtcatcaactcgttgatagactttttccaaccctacctcaactttgacgag
tacgatgccggcaaaaagaccgaccccaacgtcactgcccatgtagactttttcacaaag
attgccgattttacgagacccgatgaaaacggctccaagttgcgtcaactcgtgctggaa
cgaggcattaccaaacagctctacgaatacattgacaagaatctaccaagcgacaaggat
aaatcgtcgccagagtggattgggtcattggaacgtgccgcactcccatatgtactcgtc
cttctcaagggtcttgccaatggccacgaacccacccaactcatgtctgtcaatgaattc
aatgttctcaagcgtctccatttgatggagcagacatcgaccaccagcaccaagaatgtt
ggtagtttggcagaaaacttcctcgagtctcttcaagtcaacaacaaaaagatggccgac
gaaattcacaacattcgtacggaatcaaagagagagaaacttgcacaagccgaaaagcac
agagaaaatgtgctcaaggagcttggtctctcgcaacaaggcaagcatatcactgccaat
gttgtgccaactattatcgaggatctagaggatgaagagggattcacatgtatggtgtgt
cgtgaaggttacaactttaaaccagacgatgttttgggtatctatacctactctaaacgt
gttgcacttcatgcactcaacgaaaccactgccactccatcatcttctggtcaatctgaa
agaagagaatcatcgggtggaaatgcacactgttacactactgtcactcactttaacatt
attcactactattgtcatcgtgatgccaccaaggccgacaagagtatgaaggtgcccaaa
gaggaatgggaaggagctgccttgagaaatcaacagaccaagtgcaacaatatcttcccc
atccaaggcccaaagatcaccaacgatgcctttacaccattctgcgacaagtattggacc
aacctcaacaatgtcggtcgtattgacggtagcaatccacgtttccgtctccttgcccac
gacctcaaactcttgttcctcagattcgccaaggacgagtcatttagcaccgactctaaa
ggtggaggcaaggattccaatattagaattgtaccattctttattcagtttggaaacttt
ttgttggaccaaaagattgtcggcaaccaagccaaccaagtccgtcgtccacactttgac
aagctattcaaccagtttgtcggactctcgctcgaatcaagtatcaacaactgtactatt
gaagtggacaatgtcccctactatctcgttctttcactctaccttcaatcgttgaaggat
tggaaatcttcaagattgaatttcttgtcaaaattaatagcctatgccttttccgaaaaa
caaccagcaaacaaaaccaaattcgccattctccgcccatggttgttattctttacaatg
attgataagttccatgaaatcattcatccaccaattaaaccagaggcctctagtatcact
agtcccaccacctctaccaccaccgtattggaaccttggataatagataccaaaaccaat
ttggcatctcattatttgaaaattcaacaagactgtaaatcatttttatcatcctttgaa
gaagagtactctgtttttgaagaagaatctgaattctttgacgatttgggtttattaaaa
gaaatattggctctagattcaaaagactctaatacctatattaataatattgaacaattg
gtaaaacaaaaaaaataa

DBGET integrated database retrieval system