KEGG   Cavenderia fasciculata (cellular slime mold): DFA_11786Help
Entry
DFA_11786         CDS       T02668                                 

Definition
(RefSeq) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
dfa  Cavenderia fasciculata (cellular slime mold)
Pathway
dfa00620  Pyruvate metabolism
dfa01100  Metabolic pathways
dfa01200  Carbon metabolism
Module
dfa_M00168  CAM (Crassulacean acid metabolism), dark
dfa_M00170  C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
Brite
KEGG Orthology (KO) [BR:dfa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    DFA_11786
Enzymes [BR:dfa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     DFA_11786
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEPcase PEPcase_2 FRB_dom
Motif
Other DBs
NCBI-GeneID: 14865688
NCBI-ProteinID: XP_004350732
UniProt: F4QE77
LinkDB All DBs
Position
Unknown
AA seq 923 aa AA seqDB search
MLGPLDFGIVEKDELDRDIDKLRNILQDSIKELEKSGDGEQLIKDVKELLLAETPSERTP
EFMEKFIEKVSSLSNESALRISRTLSHCLNLANVAEQTHLIRSVKNLESEEEGVLKFSCE
DIFKQLIEAGVEPDRIYKALTEQSIELVLTAHPTQMMRRTLITKNNHIGEALEGLSNKSQ
SSRDRKDWEDQLRREISGSWLTDEIRRNKPTPLEEAQGGFSILEQNLWRTLPKFMKVLDR
TCFKYTGKNLPLGFTNIKFGSWMGGDRDGNDNVNSKVTKQVSYFSRWIAASLFYKEIDAL
LFELSMVRMTPELAEAALKAQERRNTNRPKPVLTLYKEFGGGSGIPEREGYRILLAEMRD
KMLLTKKHYEDLIGGQTPPPDHDDDDIYHTAKQVLDPLLLCYDSLISVGAIDVANGRLID
VIRQLNCFGLTLSKLDIRQESTRHSEVLDAITNYLGIGSYLSWNEKERQEFLIRELESKR
PLVPKDLPCNARVQEVLDTFRMAAELPAESLGAYVISMCQNPSDILAVELLQKESGNKFP
QRVAPLFEMIDDLERAPQTMEQLYSIKWYKDRINGSQEIMLGYSDSSKDSGRLTSSWSLY
KAQEILTKLSDKHGVKLTLFHGRGGTIGRGGAPTYLAIQSQPGGSINGRLRVTEQGEMIT
AHYGQPGVAFRSIEVYTTATLQQTLLPPPPPSDHWREIMDELSSVSGKKYRSIVRGNENF
VRYFRASTPERELSHLNIGSRPQKRNVSGGIESLRAIPWIFAFTQTRLILPAWLGVAEAL
EAAKEKGYTNDLKEMYKSWPYFQTTIDLIEMVLMKADPLIAARYNDLLVPFELQSLGKEM
IGLLNKTVSSILSLTNHSTLQQDNKLLQHFIAIRRSYLDPLNYIQAEVLRRLRSNHVEAQ
NPILVDILIISINGLAAGLRNTG
NT seq 2772 nt NT seq  +upstreamnt  +downstreamnt
atgttaggaccattagattttggaatagtagaaaaagatgaattagatagagatattgat
aaattaagaaacattttacaagattctatcaaagagttggaaaagagtggagatggagaa
caattaatcaaggatgtaaaggaattgttacttgcagagacaccaagcgaaagaacaccc
gagtttatggaaaaatttatagaaaaggtgtcttcattgtccaatgaaagtgcactacgt
atctctcgtacactcagccactgtttgaaccttgcaaacgttgcagaacagacccatcta
attcgatcggtaaagaacctagaatccgaagaagaaggtgtattaaagttttcgtgtgaa
gatatctttaagcaattgatcgaagctggtgtcgagccagaccgaatctacaaggcgctg
actgaacaatcgatcgagttggtattgacagctcatccaacccagatgatgcgtcgtact
ctcatcactaaaaacaatcacattggagaagcactcgaaggactgagcaacaagtcacaa
agctcacgtgatcgtaaagactgggaagaccaactacgtagagagattagtggatcttgg
ttgaccgatgaaatccgtagaaacaaaccaacccccctcgaagaagctcaaggcggtttc
tcaatcctcgaacaaaacctttggcgtacactaccaaagtttatgaaagttctagatcgt
acttgtttcaaatatactggtaaaaatttacctcttggttttacaaatattaaatttggt
tcttggatgggaggagatagagatggaaatgataatgtaaattcaaaagtaacaaaacaa
gtatcctatttttcaagatggatagctgcatcattattttataaagagattgatgcactg
ttgtttgaactttcaatggtaaggatgacaccagaattggcagaggctgcattgaaagca
caagaacgtagaaatacaaatagaccaaaaccagtattgactctttacaaggaatttggt
ggtggatctggtattcctgaacgtgaaggttatagaattttattggctgaaatgagagac
aaaatgttgttaaccaaaaaacattatgaagatttaattggtggtcaaacccctccacca
gatcatgatgatgatgatatctatcatactgcaaaacaagttttagatcctcttttactt
tgttatgattctttaatttctgttggtgctattgatgttgcaaatggtagattaattgat
gtaattagacaattaaattgttttggattaacattatcaaaattagatattagacaagaa
tcaacaagacattcagaagtattggatgcaattaccaattatttgggaattggatcttat
ttgtcatggaatgaaaaagagagacaagagtttttaattcgagaattggaatcaaagaga
ccacttgtaccaaaggatttaccttgtaatgctagagttcaagaggtacttgatacattc
cgtatggctgctgaattaccagctgaatcccttggtgcctatgttattagtatgtgtcaa
aatccaagtgatattttagcagttgaactccttcaaaaagagtctggtaataagtttcca
caacgtgtagctcctctgtttgaaatgattgatgatttggaacgtgctccacagactatg
gaacaattgtacagtatcaaatggtacaaggatagaatcaatggaagtcaagaaattatg
cttggttattccgactcttccaaagactctggtagattgactagttcatggtcattatac
aaggctcaagagattttgacaaaattgtctgataaacatggcgtcaaactaactctattc
catggtcgtggtggaacgattggtcgtggtggtgcaccaacctatttggccatccaatct
caaccaggtggttcaatcaatggtcgtctaagagtaactgaacaaggtgaaatgattaca
gctcattatggtcaaccaggtgtagcattccgttccatcgaagtctataccaccgccaca
ctccaacaaactctcttaccacctcctccaccaagtgatcattggcgtgaaatcatggat
gaactctcttctgtttccggtaaaaagtatcgctccatcgttagaggaaacgaaaacttt
gttcgttatttccgtgcatccactccggaaagagaactttcacatttaaatattggtagt
cgtcctcaaaagcgtaatgttagtggtggtattgaatcgcttcgtgctattccatggatt
ttcgcattcactcaaactagattaatcttgccagcttggttgggtgttgccgaggcatta
gaagcggccaaggaaaaaggttataccaatgacctaaaggaaatgtacaagtcttggcca
tactttcaaactaccattgatctcattgaaatggtgttgatgaaggctgatcccctcatt
gctgctcgttacaatgaccttttggtgccattcgaactacaatcacttggcaaggaaatg
attggtctactcaacaaaactgtatcatctattctttcactcaccaatcattcaactctt
caacaagacaacaaactattacaacatttcatcgctatacgtcgttcatatttagatcca
ctaaattatattcaagcagaagttctccgtcgtcttcgctcaaatcatgttgaagctcag
aacccaatcctcgtagatatcttaatcattagtattaatggtttagctgctggtttacgt
aatactggataa

DBGET integrated database retrieval system