KEGG   Cavenderia fasciculata (cellular slime mold): DFA_12194Help
Entry
DFA_12194         CDS       T02668                                 

Gene name
gaa
Definition
(RefSeq) alpha-glucosidase
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
dfa  Cavenderia fasciculata (cellular slime mold)
Pathway
dfa00052  Galactose metabolism
dfa00500  Starch and sucrose metabolism
dfa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dfa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    DFA_12194 (gaa)
   00500 Starch and sucrose metabolism
    DFA_12194 (gaa)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dfa04147]
    DFA_12194 (gaa)
Enzymes [BR:dfa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     DFA_12194 (gaa)
Exosome [BR:dfa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   DFA_12194 (gaa)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 14866342
NCBI-ProteinID: XP_004353831
UniProt: F4QCJ4
LinkDB All DBs
Position
Unknown
AA seq 834 aa AA seqDB search
MTTVQLTKYGYSGQLSLLSPGPYGNDIGLLYFDVYFQTQQIVRFKIYDPKNERWEVPFTN
QLPTATSKPNILDYDVKFTANPFGFTVVRIATGEILFNSSPSTGCPTNGLIFEDYYLELS
TSFTVSNPNLYGLGERAAPLRLNNSMTYTLFAKDQGTASTENINLYGSHPFYMQLLPNGN
ANGVFMLNSNAMDVVLQPNSLTYKIVGGIIDLFIFTGPTPVSVVQQYAQLIGNPHIPPYW
SLGWHQCRWGYHTVEQTEQVVANYSKYGIPLETMWNDIDYMDAYKDFTVDPVNFPQTLMF
NFVNSLHENHQHYIMIVDPGIHNEEGYAPYDDLMTLGSFITTDQGQPLIGKVWPGSTIFP
DFLDQKAWDFWQQQLQNYHDMVPFDGVWIDMNEVSNFCDGDCSDSNSKSGKMMSMFGSFD
PNNPPYLPGGVSLDQHTINLTAVQNGNISVYNSHSLYGYTEGMATVDAVHQILGTRTTVI
SRSTFPGTGSHNGHWLGDNESSYNDLYLSIPGMLNMNIFGIPLVGADICGFNKDSNSDLC
GRWMQLGNFYPFSRNHNSFNSIPQEPYVWGQAVIDVSINAINLKYTLLPYYYTLFYLANT
QGLPVMRPLFMEYPTDANTYAIDTQFLVGPSLLVSPVLTANTTTVTAYFPTDTWYDFFTG
SPVAQVGKSQVLPAPFDVINVHIRGGSILALQPTQSYVPGEGEIPITTHVARTLPFTINV
ALDSTGSAQGQLFLDDGISLDTIENGQYTVIDLQAYYDSTLGQYAFESSVSFAGSYLSNA
TISTVVIFGVSEPVSNVYVDGTPSTAYTYTAEYQSLSINNLVQSITSTNLITWN
NT seq 2505 nt NT seq  +upstreamnt  +downstreamnt
atgacaacggttcagctaacaaagtatggatacagtggtcaattaagtttactttcacct
ggaccctacggtaatgacattggtctcttgtatttcgatgtatactttcaaacacaacaa
atcgttcgattcaaaatctacgatccaaagaatgagcgatgggaagtaccattcaccaat
caactgccaactgccacctccaaaccaaacatcctagactatgacgttaaattcactgcc
aatccatttggtttcaccgtagttagaattgcaaccggtgaaatattatttaattcttca
ccatcaactggttgtccaacaaatggtttaatttttgaagattattatcttgaattatca
acaagttttacagtatctaatccaaatctttatgggttgggagaaagagctgcacctttg
agattaaacaattcaatgacttatacattgtttgccaaggatcaggggactgcgtcgaca
gagaatatcaatctctatggatcacatccattctatatgcaattgttgcccaatggtaat
gccaatggtgtgtttatgcttaattccaatgccatggatgttgtcttgcaacccaattca
ttgacctacaagattgtcggtggtatcattgacctctttatctttaccggtcccacccca
gtcagcgtcgtccaacaatacgcccaattgattggtaatcctcacataccaccctactgg
tctctcggatggcaccaatgtcgttggggttatcacactgtcgaacaaactgaacaagtt
gttgctaattattcaaaatatggtattcctttagaaacaatgtggaatgatattgattat
atggatgcatataaagattttacagttgatcctgttaatttcccacaaacgttgatgttt
aattttgtaaacagtctacatgaaaaccatcaacattatattatgattgttgatccaggt
attcataatgaagaggggtatgctccatacgacgacttgatgaccctcggatcgtttatt
acaaccgatcaaggtcaaccgttgattggaaaggtgtggccaggctcaactatattccca
gatttcctcgaccagaaagcatgggacttttggcaacaacaacttcaaaactatcatgac
atggtaccatttgatggtgtttggattgatatgaatgaagttagtaatttttgtgatggt
gattgtagcgatagcaatagcaagagtggtaaaatgatgtcaatgttcggttcatttgat
ccaaataatccaccatatctaccaggtggagtatcacttgaccaacatacaatcaatctt
acagctgttcaaaatggtaatatttcagtttacaactcacattcactttatgggtatact
gaaggtatggctactgtagatgccgtccatcaaatccttggtactcgtaccactgtcatt
agtcgttcaacttttccaggtaccggctcacacaatggtcattggttaggtgacaatgaa
tcatcctacaatgacttatacctttctatcccaggtatgctaaatatgaatatttttggt
attcctttagttggtgctgatatttgcggatttaataaagattcaaattcagatttatgt
ggtagatggatgcaattgggtaacttttacccattctctcgtaaccataattcatttaat
tcgattcctcaagaaccttatgtttggggacaagctgtcattgatgtttcgatcaatgca
atcaatctaaagtatacgctgttgccatactattatacattgttttatttggccaatact
caaggtctaccagtgatgcgtccactctttatggaatacccaaccgacgccaacacctat
gccattgacactcaattccttgttggtccatcactcttggtatcgccagtcctcactgcc
aacactactacagtcactgcttatttcccaaccgacacttggtacgatttctttactggt
tcgccagttgcccaagttggcaagtctcaagtactccctgccccattcgatgtgatcaat
gttcatattcgtggtggttccatacttgcactccaaccaacccaatcatatgttccagga
gaaggtgaaatccccatcactacccatgttgcccgtacactccccttcaccattaatgtc
gccctcgattcgactggcagtgctcaaggacaactctttttggatgatggtatctctctt
gacactatcgagaatggtcaatacactgtcattgatcttcaagcctattatgactctact
cttggacaatacgcatttgaatcatccgtctcttttgccggatcctatcttagcaatgcc
accatctctactgtcgtcatttttggtgtctctgaacctgtatccaatgtatatgttgat
ggcactccaagcaccgcctatacctataccgctgaataccaatctctctctattaataac
cttgtccaatcaatcacttctactaatcttatcacttggaattaa

DBGET integrated database retrieval system