KEGG   Deinococcus ficus: DFI_03685Help
Entry
DFI_03685         CDS       T05674                                 

Definition
(GenBank) L-threonine 3-dehydrogenase
  KO
K00060  threonine 3-dehydrogenase [EC:1.1.1.103]
Organism
dfc  Deinococcus ficus
Pathway
dfc00260  Glycine, serine and threonine metabolism
dfc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dfc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DFI_03685
Enzymes [BR:dfc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.103  L-threonine 3-dehydrogenase
     DFI_03685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C FAD_binding_3 Pyr_redox_2 HI0933_like Pyr_redox_3 FAD_oxidored 2-Hacid_dh_C Methyltransf_25 MTS Pyr_redox
Motif
Other DBs
NCBI-ProteinID: ASN81983
UniProt: A0A221SZA7
LinkDB All DBs
Position
complement(734447..735496)
Genome map
AA seq 349 aa AA seqDB search
MTALSKQEAREGIWMIDTDVPTPGPNDLLIRVRKSSICGTDVHIYKWDSWAQKTIPVPMV
VGHEYVGEVVGMGSEVQGFQIGDRVSGEGHVTCGHCRNCRAGRRHLCRNTLGVGVNRPGS
FAEYLVLPAFNAFKLPQDIPDDIAAIFDPFGNAVHTALQFDLVGEDVLITGAGPIGVMAA
AVAKHVGARNVVITDVNEYRLDLARKMGVTRAVNVAQEDLWHVATTELDMHEGFDVGLEM
SGSGPAFAQMVQAMNNGGKIALLGIPSGDVQIDWNAVIFKMLTIRGIYGREMFETWYKMA
ALIQSGLDLSPVITHHYGIRDFQQGFDAMLSGQSGKVILDWADLKAPGA
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccctgagcaaacaggaggcccgcgagggcatctggatgatcgacaccgacgtg
cccacccccggcccgaacgacctgctgatccgggtgcgcaagagcagcatctgcggcacg
gacgtgcacatctacaagtgggacagctgggcgcagaagaccattccggtgcccatggtg
gtcgggcacgagtacgtgggtgaggtggtcgggatgggcagcgaggtgcagggcttccag
atcggggaccgggtgagcggcgagggccacgtcacctgcgggcactgccgcaactgccgc
gcgggccgccggcacctgtgccgcaacacgctgggcgtgggcgtgaaccgccccgggtcg
ttcgcggagtacctggtgctgccggccttcaacgctttcaagctgccgcaggacatcccg
gacgacatcgccgcgatcttcgatccgttcgggaatgcggtgcacacggccctgcagttc
gatctggtgggcgaggacgtgctgatcacgggcgccgggccgatcggggtgatggcggcg
gccgtggcgaaacacgtgggcgcgcgcaacgtggtgatcacggacgtgaacgagtaccgc
ctggacctcgcgcggaagatgggcgtgacccgcgccgtgaacgtggcgcaggaggacctg
tggcacgtcgccacgaccgaactcgacatgcacgagggcttcgacgtgggcctggaaatg
agcgggtcgggccccgccttcgcgcagatggtgcaggccatgaacaacggcgggaagatc
gcgctgctgggcattcccagcggggacgtgcagatcgactggaacgccgtgatcttcaag
atgctcaccatccgcggcatctacggccgggagatgttcgagacgtggtacaagatggcc
gccctgatccagtccggcctggacctgagccccgtgatcacgcaccactacggcatccgc
gacttccagcagggtttcgacgcgatgctcagcgggcagagcgggaaggtcatcctggac
tgggcggacctgaaggccccgggcgcctga

DBGET integrated database retrieval system