KEGG   Deinococcus ficus: DFI_07930Help
Entry
DFI_07930         CDS       T05674                                 

Definition
(GenBank) 6-bladed beta-propeller
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
dfc  Deinococcus ficus
Brite
KEGG Orthology (KO) [BR:dfc00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dfc01001]
    DFI_07930
Enzymes [BR:dfc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     DFI_07930
Protein kinases [BR:dfc01001]
 Serine/threonine kinases: Other
  Bacterial family
   DFI_07930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr NHL APH SGL Pkinase_fungal Kdo
Motif
Other DBs
NCBI-ProteinID: ASN80936
UniProt: A0A221SWF3
LinkDB All DBs
Position
complement(1613103..1615208)
Genome map
AA seq 701 aa AA seqDB search
MSWALLLSLFAVAFLLSVRAPERVLALLLTALGLVAAGLLAYLAVQVGTDPAGWQSGRLT
GPLTALGFVVGSGLVLMGRMLTPSLDRPSPLLSVPFRAVSQTNAGARRTASGTASRRSAL
NAPLTDVDFQEYDVLERIGIGGMGSVYKARRRTDGRIVALKVPQEKYLADAKFVKRFYRE
AEVLKRFNHPNIVRVYDYRMQDPEHYIAMEYLEGQSLETLLEERKLDFSEATQMIRAMAD
ALRHIHMQNVVHRDIKPANVMVLRGAFVDGRLREGGVKLMDFGIAVGKVLTRLTMTGARV
GTPIYMAPEQAKGNRVDARSDVYSLGLLAYEMVAGQTAFKGSYEAVVHQQVFESPKPPKQ
VRLEVPGRLNDLILHMIEKDPAQRPTLDEVIARLDAGVMTDDAFNEPVALALSVQERRGT
LRLLDLKGKLRVSLRDQRATEDGLPGVPVAIAGDARGHLFVALQDYRQGRSGALIRKLDA
AGQEQLSFGAYGLGEAELLKPVSMTLSGGRLYVLDAEACRVVVYEDGQYVHAFGGIGKGN
GRFEKPRVVAAAPGGEVYVLDMGAQEVQRFTPHGEYLSRYAFRMDRTSETLRPLDGLAVD
ASGAVYIADSVARKLRKIEADGTPGLTFTLESLVGEATDAPWLLSVAPGGEIFAMRQGGQ
VLRTFSAAGDLLSQTDMYAPVQALTVVERPVVNVPRAGLPA
NT seq 2106 nt NT seq  +upstreamnt  +downstreamnt
gtgagctgggcgctgcttctttccctgttcgctgtggcgttcctgctcagcgtccgcgcg
cccgagcgcgtgctcgccctgctgctcaccgcgctggggctcgtggcggcgggcctgctg
gcgtacctggcggtccaggtgggcaccgacccggccgggtggcagagtggccgcctgacg
gggcccctcaccgcgctgggcttcgtggtcggctcgggcctggtgctgatgggccggatg
ctcacgccgtccctggaccgtccctccccgctgctcagcgtgccgttccgcgccgtgtcg
cagacgaacgccggcgcgcggcgcaccgccagtggcaccgcgtcgcgccgcagcgccctg
aacgccccgctgaccgacgtggacttccaggagtacgacgtgctggaacgcatcgggatc
ggcgggatgggcagcgtgtacaaggcccgccgccgcaccgacggccggatcgtggcgctg
aaggtcccgcaggagaagtacctcgccgacgcgaagttcgtgaagcgcttctaccgcgag
gcggaggtcctcaagcgcttcaaccacccgaacatcgtgcgggtgtacgactaccgcatg
caggaccccgagcattacatcgccatggaatacctcgagggccagagcctggagacgctt
cttgaggaacgcaagctcgacttcagcgaggccacccagatgatccgcgccatggccgac
gcgctgcgccacattcacatgcagaacgtcgtgcaccgcgacatcaagcccgccaacgtg
atggtcctgcgtggcgcgttcgtggacggccgcctgcgcgagggcggcgtgaaactcatg
gacttcggcatcgcggtcggcaaggtcctgacccgcctcaccatgaccggcgcccgggtc
ggcacgcccatctacatggcgcccgaacaggccaagggcaaccgcgtggacgcccgcagc
gacgtgtactccctgggcctgctggcctacgagatggtcgccggtcagaccgccttcaag
ggcagttacgaggccgtggtgcaccagcaggtgttcgagtcgcccaagccacccaagcag
gtgcggctggaagtgccgggccgcctgaacgacctgatcctgcacatgatcgagaaagac
cccgcccagcgccctacgctcgacgaggtgatcgcccgcctggacgccggcgtgatgacc
gacgacgccttcaacgagccggttgcgctggccctgagcgtgcaggagcggcgcggcacg
ctgcgcctgctggacctgaaaggcaagctgcgggtcagcctgcgcgatcagcgcgccacc
gaggacggcctgcccggcgtgccggtcgccatcgccggggacgcccgcgggcacctgttc
gtggcgctgcaggactaccgccagggccgcagcggcgcgctgatccgcaaactggacgcc
gccgggcaggagcagctgagtttcggcgcgtacggcctgggcgaggccgagttgctcaag
ccggtgtccatgaccctgtccggcgggcgcctgtacgtcctggacgccgaggcctgccgg
gtcgtggtgtacgaggacggccagtacgtgcacgccttcggcgggatcggcaagggcaac
ggccgcttcgagaaaccccgcgtggtcgcggccgctccgggcggcgaggtgtacgtgctg
gacatgggcgcccaggaggtgcagcgcttcacgccgcacggcgagtacctcagccgctac
gccttccgcatggaccgcaccagcgagaccctgcggcccctggacggcctggccgtggac
gccagcggcgcggtgtacatcgccgacagcgtggcccgcaagctgcgcaagatcgaggcg
gacggcacccccggcctcaccttcaccctggagtccctggtcggggaggccacggacgcg
ccctggctgctcagcgtcgcgccgggcggcgagatcttcgccatgcggcagggcgggcag
gtgctgcgcaccttctccgccgccggggacctgctcagccagacggatatgtacgcgcct
gtgcaggcgctcaccgtcgtggaacgccccgtggtcaatgttccccgggcggggctgccc
gcatga

DBGET integrated database retrieval system