KEGG   Deinococcus ficus: DFI_07945Help
Entry
DFI_07945         CDS       T05674                                 

Definition
(GenBank) pyrroline-5-carboxylate reductase
  KO
K00286  pyrroline-5-carboxylate reductase [EC:1.5.1.2]
Organism
dfc  Deinococcus ficus
Pathway
dfc00330  Arginine and proline metabolism
dfc01100  Metabolic pathways
dfc01110  Biosynthesis of secondary metabolites
dfc01130  Biosynthesis of antibiotics
dfc01230  Biosynthesis of amino acids
Module
dfc_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:dfc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    DFI_07945
Enzymes [BR:dfc01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.2  pyrroline-5-carboxylate reductase
     DFI_07945
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: P5CR_dimer F420_oxidored
Motif
Other DBs
NCBI-ProteinID: ASN80938
UniProt: A0A221SWC1
LinkDB All DBs
Position
complement(1618056..1618847)
Genome map
AA seq 263 aa AA seqDB search
MKLAIVGVGKLGLSLLEGVTRRSVLAPQDIGLIDIHTERTAEIAERTGAVLLDPAQLGRA
ERIVIALQPRAFPAAAEWLAQENAGYISTMAGVSLSALSRRLGTKRVVRVMPNLGATIGL
SQTAIAAPKEAVQAGDHAFAHQLFDAVGDAYDLPENLFDVFTGMSASGPGYAAVVAEALA
DGAVRMGMPRALAQELAAKLLVTSGELLQRRLHPGLLKDEVASPGGTTIAGLSALESAGV
RGGLMAAVEAATRRSTDLGRDQE
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgaagctcgccatcgtcggcgtcggcaaacttggcctgtccctgctggagggcgtcacc
cggcgcagcgtgctcgccccgcaggacatcggcctgatcgacattcacaccgaacgcacc
gcggagatcgccgaacgcaccggcgccgtcctcctcgacccggcgcagctcggccgggcc
gagcgcatcgtgatcgccctgcagccccgcgccttcccggccgccgccgagtggctcgcg
caggagaacgccgggtacatcagcaccatggccggcgtgagcctcagcgccctgtcgcgc
cgcctgggcaccaaacgcgtcgtgcgggtcatgccgaacctgggcgccaccatcggcctc
agccagaccgccatcgccgcgccgaaggaggccgtgcaggccggcgaccatgccttcgcg
caccagctgttcgacgcagtcggggacgcctacgacctcccggagaacctgttcgacgtg
ttcaccggcatgagcgccagcggccccgggtacgccgccgtggtcgccgaggccctcgcc
gacggcgccgtgcgcatgggcatgccccgcgcgctcgcgcaggaactcgcggcgaaactc
ctggtcaccagcggcgaactgctgcaacgccgcctgcaccccggcctgctcaaggacgag
gtcgccagccccggcggcaccaccatcgccggcctcagcgccctggaatccgccggcgtg
cgcgggggcctgatggccgccgtggaggccgccacccgccgcagcaccgacctgggccgc
gaccaggagtaa

DBGET integrated database retrieval system