KEGG   Deinococcus ficus: DFI_09175Help
Entry
DFI_09175         CDS       T05674                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
dfc  Deinococcus ficus
Pathway
dfc00620  Pyruvate metabolism
dfc00680  Methane metabolism
dfc01100  Metabolic pathways
dfc01120  Microbial metabolism in diverse environments
dfc01200  Carbon metabolism
Module
dfc_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:dfc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    DFI_09175
  09102 Energy metabolism
   00680 Methane metabolism
    DFI_09175
Enzymes [BR:dfc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     DFI_09175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ASN81155
UniProt: A0A221SWX3
LinkDB All DBs
Position
1878411..1880921
Genome map
AA seq 836 aa AA seqDB search
MGIRSDVNLLGRTLGQVIREQEGEAFFDLVERTRALVREARAGEGDVELRAMIGGLSGAE
AGRLARAFTWYFQLVNLAEEYERVRVLRAAGGVRSQSLEGALTELKAQGLEAAEVEALIE
RLDLGLTFTAHPTEMRRRTVRAHLVAVARAIPELESESLREEALERVAAHVEAMWTTPEL
RHLKPTVLDEVKGGLSYIPNIARALPSLQRDLQRAFRHVYGVESEAALPLSFSSWMGGDR
DGNPFVTPQATQEALGLHRDRAREVLLGAITQAYADLSQETAGQTEVGDGKEPYRQELRA
LHDAVRDGVPVELLPRLEALHARLHADGQHRSADQLLMPLLTVARVFGQHLVSLDIREHS
AQVGAAVAELLRAAGVEANYQDLPEHAKLDLLTGELRSRRPLWPAGEALPDALEAAIGPV
REVRAAVQAVGPGAFGRYVISMAESVSDVLEPLLLAREVGFRVLPVPLFETLDDLRRAPQ
VVWELLSVPEYRAVLGDDVQEIMLGYSDSNKDAGFLAANWALHEAQRKISEVCRRAGVRW
RFFHGRGTSIGRGGGPAGRAILGQPAGTIDAGLRITEQGEALADKYSHPMLARRNLEQAL
YGLLLAAARPPVDPPAAWLAAMDRAAGASAAAYRALVDNPAFLPFFEAVTPIHEIARLNI
ASRPVRRPGAPTLGNLRAIPWVMSWTQNRVNLPGWYGLREGLREIGLDAAREMYRDWPFF
RAVLDNAQMSLAKSDPLIVGEYLRLGTDAHPTGTALLDAYADTVALVQDVVGAELMANEP
RLKESIALRNPYIDPLHRIQAELLRRSRAEPGGLDEFEVPLLLSIQGIAAGVRNTG
NT seq 2511 nt NT seq  +upstreamnt  +downstreamnt
atgggcattcgcagtgacgtgaatctgttgggccggacgctgggccaggtcatccgggag
caggagggcgaggcgttcttcgacctggtggaacgcacgcgcgcgctggtgcgggaagcc
cgcgcgggcgagggcgacgtggaactccgcgccatgatcggcggactgtccggcgcggag
gcggggcggctggcgcgggcgttcacgtggtacttccagctggtgaacctggccgaggag
tacgagcgggtgcgggtgctgcgcgcggccggcggcgtgcggtcgcagagcctggagggc
gccctgaccgaactgaaggcccagggcctggaggctgcggaggtggaggcgctgatcgag
cggctggatctgggcctgaccttcacagctcaccccacggagatgcggcgccgtacggtg
cgggcgcacctggtggcggtggcgcgcgccattccggaactggagtccgagtcgctgcgc
gaggaggcgctggagcgcgtggcggcgcacgtggaggcgatgtggaccacgccggagctg
cggcacctgaagcccaccgtgctggatgaggtgaagggcggcctgagttacatcccgaac
attgcgcgggccctgccgagcctgcaacgggacctgcagcgcgcgttccggcacgtgtac
ggcgtggagtcggaggcggcgctgccgctgagtttctcgtcgtggatgggcggggaccgg
gacggcaacccgttcgtgacgccgcaggcgacccaagaggcgctgggcctgcaccgggac
cgggcgcgggaggtgctgctcggggcgatcacgcaggcgtacgcggacctgagtcaggaa
acggccgggcagaccgaggtgggggatgggaaggaaccctaccgacaggagctgcgggcc
ctgcacgacgccgtgcgggacggggtgcccgtagagctgctgccgaggctggaggccctg
cacgcccggctgcacgccgacgggcagcaccgcagcgcggatcagctgctgatgccgctg
ctgacggtggcgcgggtgttcgggcagcacctggtgagcctggacatccgcgagcacagc
gcgcaggtgggcgcggcggtggcggagttgctgcgcgcggcaggcgtggaggcgaactac
caggacctgcccgagcacgcgaaactggacctgctgaccggtgaactgcggtcccgccgc
ccgctgtggccggcgggcgaggcgctgccggacgcgctggaggcggccatcggtcccgtc
cgggaggtccgggcggcggtgcaggcggtggggccgggcgcgttcgggcggtacgtgatc
agcatggccgagagcgtcagtgacgtgctggagccgctgctgctggcgcgggaggtgggg
ttccgggtgctgccggtgccgctgttcgagacgctggacgacctgcgccgcgccccgcag
gtggtgtgggagctgctgagcgtgcccgagtaccgcgcggtgctgggcgacgacgtgcag
gagatcatgctgggttacagcgacagcaacaaggacgccgggttcctcgcggcgaactgg
gcgctgcacgaggcgcagcgcaagatcagcgaggtgtgccgccgcgcgggcgtgcgctgg
cgctttttccacgggcgcggcaccagcatcggccggggcggcgggccggccggccgggcg
atcctggggcagccggccggcaccatcgacgcgggcctgcgcatcacggagcagggggag
gcgctggccgacaagtacagccaccccatgctggcccgccggaacctggagcaggcgctg
tacggcctgctgctggccgcggcccggccgccggtggacccgccggccgcgtggctggcg
gcgatggaccgcgcggccggcgcgagcgcggcggcataccgcgcgctggtggacaacccg
gcgttcctgccgtttttcgaggcggtcacgcccattcacgagatcgcccgactgaacatc
gcgtcccggccggtgcggcggcccggcgcgccgacgctggggaacctgcgcgcgattccg
tgggtgatgtcctggacgcagaaccgcgtgaacctgcctggctggtacgggctgcgcgag
ggcctgcgggagatcgggttggacgcggcccgcgagatgtacagggactggccgttcttc
cgggcggtgctggacaacgcgcagatgagcctcgccaagagcgacccgctgatcgtgggc
gagtacctgcgcctgggcacggacgcccaccccaccgggacggcgctgctggacgcgtac
gcggacacggtggcgctggtgcaggacgtggtgggggcggagctgatggcgaacgagccg
cgcctgaaggagagcatcgcgctgcgcaacccgtacatcgatccccttcaccgcattcag
gcggaactgctgcgccgcagccgcgcggagccgggcggcctggacgagttcgaggtgccg
ctgctgctcagcattcagggtatcgcggcgggggtgcgcaacaccgggtaa

DBGET integrated database retrieval system