KEGG   Desulfurococcus amylolyticus DSM 16532: Desfe_1247Help
Entry
Desfe_1247        CDS       T02136                                 

Definition
(GenBank) ribulose 1,5-bisphosphate carboxylase large subunit
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
dfd  Desulfurococcus amylolyticus DSM 16532
Pathway
dfd00630  Glyoxylate and dicarboxylate metabolism
dfd01100  Metabolic pathways
dfd01120  Microbial metabolism in diverse environments
dfd01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dfd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Desfe_1247
Enzymes [BR:dfd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Desfe_1247
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N LigA DUF697 Vps23_core
Motif
Other DBs
NCBI-ProteinID: AFL67116
UniProt: I3XT42
LinkDB All DBs
Position
1183174..1184511
Genome map
AA seq 445 aa AA seqDB search
MSGKFEFETYHEYIDKNYTPDPSNDVIAVYRVKPAQGFTIEDAAGGVAAESSTGTWTSLY
NWYDVGRVRRLSGKAYYFKDLGDGSWIVKIAYPVELFEEGNIPGLLASIAGNIFGMKRVE
GLRLEDIYLPKKFLESFKGPSKGLNGVREIFGIKDRPIVGTVPKPKEGYSPEEVEKLALE
LLSGGLDYIKDDENLTSPSFCRFEARAKAIMKVIDKVEKETGERKVWFANITSDIREMER
RLRLVADYGNPYIMVDVVIAGWSALTYIRDLAEEYGLAIHGHRAMHAAFTRNPYHGISMY
VLAKLYRIIGIDQLHIGTAGAGKLEGGKLDVVRYAKILRETHFKPDPDDIYHLEQPMHHI
KPAMPVSSGGLHPGNLPPVIEALGTNLVLQIGGGVIGHPDGPRAGALAVRQALEAIMNNI
PLDEYAKTHRELARALEKWGFVKPI
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgagtgggaaattcgagtttgaaacataccacgagtacatagacaagaattatactcct
gaccccagcaacgatgtaatagctgtatacagggttaagcctgcacagggattcactatt
gaggatgctgcgggaggtgtagccgctgagagtagtactggtacgtggaccagtctttac
aactggtacgatgtagggagagttagaaggctgagtggtaaagcatactacttcaaagat
cttggcgatggatcatggattgtgaaaatagcatacccagtggagttattcgaggaagga
aatataccgggcctgctggcatccatagctggaaacatattcggtatgaagcgtgttgaa
ggattacgactcgaggacatatatctccccaagaaattcctcgagtcatttaagggaccc
agtaagggattaaatggtgttagagagatattcgggataaaggataggcctatagtaggc
acggtgccgaagcccaaggagggttactcaccggaggaagtggagaagctggctttagag
ttgctaagcggtggattagactacataaaagacgatgaaaacctgaccagcccaagcttc
tgtaggttcgaggccagagctaaggccattatgaaggtcattgataaagtagagaaagag
acaggtgagagaaaagtctggttcgccaatattacctccgatatacgtgaaatggagagg
aggctgaggcttgtagcagactacggtaacccatacataatggttgatgtcgtgatcgcc
gggtggagcgcgctgacatatatcagggatctagcagaggagtatggactagcaatacat
gggcacagagcgatgcatgcagccttcactaggaatccataccacggcatctcaatgtac
gtgctggctaaattatacaggatcataggaatagaccaactacacatcggcacagccggg
gcaggaaaactcgagggcgggaagctagacgttgtaagatacgctaaaatactgagagag
acacacttcaagccagacccagatgacatataccacctagagcaaccaatgcaccacatc
aagccggcaatgcctgtctcatcaggtggtttacacccaggtaacctcccaccagtaata
gaggctctaggtacaaacctggtgctacaaataggtggtggggtaataggtcatccagac
ggacccagagccggagcactagctgttagacaggcactagaggcaataatgaataatatt
ccactagacgagtacgctaaaacacatagagagctggcaagagcactggagaaatggggc
ttcgtaaaacccatctag

DBGET integrated database retrieval system