KEGG   Dyadobacter fermentans: Dfer_2083Help
Entry
Dfer_2083         CDS       T00970                                 

Definition
(GenBank) alpha amylase catalytic region
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
dfe  Dyadobacter fermentans
Pathway
dfe00500  Starch and sucrose metabolism
dfe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dfe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Dfer_2083
Enzymes [BR:dfe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     Dfer_2083
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     Dfer_2083
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase hDGE_amylase Malt_amylase_C
Motif
Other DBs
NCBI-ProteinID: ACT93306
UniProt: C6VXG3
LinkDB All DBs
Position
complement(2537995..2539620)
Genome map
AA seq 541 aa AA seqDB search
MLEELWYKNAVIYSLDLETFMDGNNDGTGDFEGLCNRLDYLHALGLDTIWLAPFQPTPNR
DNGYDISDFYGVDPRHGSSGDFVDFIHKARKLGIKVIIDLVVNHTSDEHRWFKESRSSKD
NPKRHWYVWSDKRPKGWNKGMVFPGVQKATWTRDKKTGDYYFHRFYEFQPDLNTDNPEVR
AEINRIMGYWLELGIAGFRVDAVPFILESPAAEGKSPLHFEYLKEMRRFLQWRRGDAVLL
GEANVLPQESKKYFGENGEGIHLMFNFYVNQYTFYALATADTRPLIKALEATREKAPGSQ
WAFFLRNHDELDLDRLAPEERQIVFDRFGPEKNMQIYERGIRRRLSPMLGNRQQTELAYS
LMFSFPGTPVIRYGDEIGMGDNLALQERDAVRTPMQWSGEVNGGFSRANKLIHPVIDEGY
YAYEHVNVEHQRRDAGSLLNWMTTLIRLRKECPEIGYGEWEIIDTGYREILGMRYTWRNR
SLLIWHNFSEKSLELVVPENQAGTGRLIDLMNNIESVLDHKGRHTITLEAYGYRWFKAQL
G
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgctggaagaactttggtataaaaacgccgtcatttacagcctcgaccttgagactttt
atggacggcaacaatgatggtacgggcgatttcgaaggactttgcaatcgcctcgattat
ttacatgcattggggctggacacgatctggctggccccgttccagcccactccgaaccgc
gacaacggctatgatatcagcgatttctacggcgtagacccgcgccatggttccagcggc
gatttcgtggattttattcacaaagcccgcaagctggggattaaagtaatcatcgaccta
gttgtgaatcatacttccgacgaacaccggtggtttaaagaatcgcgcagttccaaagat
aatcccaaacggcactggtacgtgtggtcggacaagcggcccaaaggctggaacaaaggg
atggtattccccggcgtacaaaaagccacctggacgcgcgacaagaaaaccggcgactat
tattttcatcggttttacgaatttcagcccgatctcaatacggataacccggaagtccgc
gcggaaatcaaccgcatcatgggttactggctcgaactcggcattgcaggtttccgtgtc
gacgccgttccgtttatcctcgaatcgcccgcggcggagggtaaatcgcccctgcatttt
gaatacctgaaagaaatgcgccgtttcctgcaatggaggcggggagatgcggtgctgctc
ggcgaggctaacgtgctgccgcaagaaagcaagaagtatttcggcgagaacggggaaggt
attcacctcatgtttaatttttatgtaaaccaatacacgttctacgcgctggccaccgcc
gatacgcgcccgctcattaaagcactggaagcgacgcgcgaaaaagcgccggggagccaa
tgggcattcttcctccgcaaccacgatgagctggacctggacaggctcgcacccgaggag
cggcagattgtatttgaccgtttcgggccggaaaaaaacatgcagatttacgaacgcgga
atccgccgccggctttccccaatgcttggcaaccgccagcaaaccgaactcgcttacagc
ctgatgttctcattccccggcacgcccgtgatccgctacggcgatgagatcgggatgggt
gataacctggcacttcaggaacgcgacgctgtgcgtacacccatgcaatggtcgggcgaa
gtgaatggcggcttttcgagggctaacaagctgatccatccggtgatcgatgaaggatat
tatgcctatgagcatgtcaatgtggagcaccagcggcgcgacgcgggctcgctgctcaac
tggatgaccacgctgatccggctccggaaagaatgtcccgaaatcggctacggcgagtgg
gaaattatcgacaccggttaccgtgaaatattgggaatgcggtatacctggagaaaccgg
tcgctgcttatctggcacaatttcagtgagaagtcgctggaactcgttgtgcctgaaaac
caggcaggtacaggtcggctgatagacctgatgaacaacatagaaagcgtgctggaccac
aagggccggcataccattacgctggaagcgtacgggtaccgatggttcaaggcacaactg
ggatag

DBGET integrated database retrieval system