KEGG   Dyadobacter fermentans: Dfer_2906Help
Entry
Dfer_2906         CDS       T00970                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
dfe  Dyadobacter fermentans
Brite
Enzymes [BR:dfe01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Dfer_2906
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ACT94121
UniProt: C6W4M0
LinkDB All DBs
Position
3571598..3572320
Genome map
AA seq 240 aa AA seqDB search
MNRTDFLRTLAGSALTVGTLAEQSFAGVAQTSGSILAETAPFKQAPLPYDFGALEPSIDK
LTMEIHYGKHHTAYIKNLNDAVKGTEWEKKSLEDIIKGVSKAPAAIRNNGGGHWNHTFFW
EVMGPKKAAAPSGAVADAINGQFGSFEKFKEEFGKAAATRFGSGWAWLVAKGGKLAVGST
PNQDNPLMDVSDFKGTPILGIDVWEHAYYLHYQNKRPDYVKAFWDVVNWDKVAENLKKAK
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgaatagaacagactttttgcggacactcgccggcagcgcactcactgttggcacattg
gctgaacaatcatttgcaggagtagcgcaaacatccggcagcatactcgcggaaaccgct
ccattcaagcaagccccgcttccctacgacttcggcgcattggaaccgagcatcgacaaa
ctgacgatggaaatccactacggcaagcaccatactgcatacatcaaaaatctgaacgac
gctgtaaaaggcaccgaatgggagaaaaagtccctcgaagatatcatcaaaggagtgagc
aaagcacccgcggccatccgcaacaacggcggcggccattggaaccacactttcttctgg
gaagtaatgggccccaaaaaagcagcagcccccagcggcgccgtagccgacgcgatcaac
ggtcagttcggttcatttgagaaattcaaagaagaattcggcaaggcggcggctacccgc
ttcggttcgggctgggcatggctggtggccaaaggcggaaaactcgcagtaggctccacg
cccaaccaagacaacccgctcatggacgtttccgatttcaaaggcacgcccattctcggc
attgatgtttgggagcatgcctattacctgcactaccaaaacaaacgcccggattatgta
aaggcattctgggatgtggtgaactgggataaagtggcagaaaatttgaaaaaagctaaa
tag

DBGET integrated database retrieval system