KEGG   Dyadobacter fermentans: Dfer_3020Help
Entry
Dfer_3020         CDS       T00970                                 

Definition
(GenBank) Exo-alpha-sialidase
  KO
K01186  sialidase-1 [EC:3.2.1.18]
Organism
dfe  Dyadobacter fermentans
Pathway
dfe00511  Other glycan degradation
dfe00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:dfe00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Dfer_3020
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Dfer_3020
Enzymes [BR:dfe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     Dfer_3020
Bacterial toxins [BR:dfe02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   Dfer_3020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BNR_2 BNR BNR_3 Sortilin-Vps10
Motif
Other DBs
NCBI-ProteinID: ACT94235
UniProt: C6W5L7
LinkDB All DBs
Position
complement(3693050..3694216)
Genome map
AA seq 388 aa AA seqDB search
MRYLKYTLLLKLFVIMHYAIGQTPVFVSGSDGYKSYRIPAIVRTPAGDLLAFAEGRVGGS
GDFGDIDIVMKRSRDGGKTWSAMQVVANYNDLQAGNPAPVMDLTDPAFPKGRLFLFFNTG
NNHEGEVRKGKGLREVWYKTSTDNGATWSEPENITTQVHRPKQPTVNAAYDFAEDWRSYA
NTPGHALQLTEGKLKGRIYIPANHSAGDPKPKFTDYQAHGFYTDDHGKTFKLSETISVEG
GNEATAAELSGGRLLFNARNQKGDVRARIVAISSDGGAKWDTTFFDQNLPDPVCEGSILT
IGKSKGNNILAFCNAADTQARDNLTLRISFDDGKTWAKSYPVDKSTAGEKDFTAYSDIVK
TGKQAIGVLYERDGYKSIVFKEIRWDAK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgagatatttaaaatacacgttgctgctgaaattgtttgttataatgcattacgccatc
ggtcagacgcccgttttcgtgtcggggagtgacggctataaatcgtatcgcatacccgcg
atcgtgcgtacgcctgcgggcgacctgctggcgttcgcggaaggcagggtaggcggcagc
ggcgactttggggacattgatattgtgatgaaacggagcagggacggaggcaaaacctgg
tctgcaatgcaggtggtggctaactataacgacttgcaggccggaaacccggcgcctgtg
atggacctcacggaccccgcatttcccaaaggcaggcttttcctgtttttcaatacgggc
aataaccacgaaggcgaagtaaggaaaggcaagggcctgcgcgaagtttggtataaaact
tcgacagacaatggcgctacatggagcgagcccgagaacattaccacgcaggtgcaccgc
ccgaaacagcccacggtgaatgccgcttacgatttcgcggaggattggcggagctatgcc
aatacgcccggccacgcattacaactcaccgaaggaaaattgaaaggccgcatttacatt
ccggctaatcacagcgccggcgatccgaaaccgaaattcaccgattaccaggcccacgga
ttttacacggacgaccacggcaagacgttcaaactcagtgaaacgatctccgtggaaggc
ggcaacgaggccacggccgcggagctgtcgggcgggcggctgctgttcaatgcgcgcaac
cagaaaggcgacgtgcgcgcgcggatcgtagcgataagctccgacggcggcgcgaaatgg
gatacgacgttttttgaccaaaacctgccggaccccgtctgcgaaggtagcattcttacc
atcggcaagagcaagggcaataacatcctcgcgttctgcaacgccgccgatacccaggcc
cgcgacaacctgactttacgcatcagcttcgacgacgggaaaacctgggcaaaaagctat
ccggttgacaaaagcacggcgggagaaaaggatttcacggcatattcggacattgtgaaa
accggcaagcaagcaatcggcgtcctgtacgagcgcgacgggtacaagtcgatcgtgttc
aaagaaatccgctgggacgcgaaatag

DBGET integrated database retrieval system