KEGG   Dyadobacter fermentans: Dfer_3085Help
Entry
Dfer_3085         CDS       T00970                                 

Definition
(GenBank) DNA polymerase LigD, polymerase domain protein
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
dfe  Dyadobacter fermentans
Pathway
dfe03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:dfe00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    Dfer_3085
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:dfe03400]
    Dfer_3085
Enzymes [BR:dfe01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Dfer_3085
DNA repair and recombination proteins [BR:dfe03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     Dfer_3085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_primase_S AAA_assoc_C
Motif
Other DBs
NCBI-ProteinID: ACT94300
UniProt: C6W6G0
LinkDB All DBs
Position
3773083..3773982
Genome map
AA seq 299 aa AA seqDB search
MKKKAEITHPEKIYWPDEHITKGELIDYYRNIATYILPYMKNRPLSLRRQPNGIKDEGFF
QKDASDSVPEWIKTFEILAESTGKMVNYHVVNDVESLLYIANLGCIEMNPWNSTINKLEN
PDWVVMDIDPSAKNTFDDVIDVALTIKQILGEMDVEGFCKTSGASGMHVYIPFGRKYDYD
QARDFAELLAHMVVERIPKITTLERSLSKRKKNQIYVDYLQNRIGQTLACAYSARPKPGA
TVSTPLEWSEVQHGLSPKDFTIKNIFDRLDKKGDLFKGVLGKGINLKKALQKLSVPAQD
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagaaagcggagatcacccatcccgagaaaatttactggcccgacgagcacatt
accaaaggcgagctgatcgattattaccggaatatcgcgacatacattctgccatatatg
aaaaacaggccgctttcgctgcgcaggcagcccaatggcattaaagacgagggatttttc
cagaaagacgcgagcgattcggtgccggaatggatcaaaacctttgaaatactggccgaa
tccacaggaaagatggtcaattaccatgtggtgaacgatgtcgaaagcctgctttacatc
gcgaacctgggctgcatcgaaatgaacccttggaattcgaccatcaacaagctggaaaat
ccggattgggtggtgatggacatcgacccgtcggccaaaaacacgttcgatgacgtgatc
gacgtcgcattgaccatcaaacaaatcctcggcgaaatggacgtggaagggttttgcaaa
acctccggcgcgagcggtatgcacgtttacattccattcggcagaaaatacgattacgac
caggcccgcgactttgctgaactgctcgcgcacatggtggtggaacggataccgaaaatc
accacgcttgaacgctcactctcgaaacgcaaaaagaatcagatttacgtggattacctg
caaaaccgcatcgggcaaacactcgcatgtgcgtacagcgcccgcccgaaacccggcgca
acggtgtcaacgccgctggaatggagcgaagtgcagcacggcctgagcccgaaggatttt
acaattaagaacattttcgaccggctcgacaaaaaaggtgaccttttcaaaggtgtgctc
ggcaagggcattaacctcaaaaaagccctgcaaaagctctcggtaccggcccaggattag

DBGET integrated database retrieval system