KEGG   Dyadobacter fermentans: Dfer_3102Help
Entry
Dfer_3102         CDS       T00970                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
dfe  Dyadobacter fermentans
Pathway
dfe00010  Glycolysis / Gluconeogenesis
dfe00030  Pentose phosphate pathway
dfe00051  Fructose and mannose metabolism
dfe00052  Galactose metabolism
dfe00680  Methane metabolism
dfe01100  Metabolic pathways
dfe01110  Biosynthesis of secondary metabolites
dfe01120  Microbial metabolism in diverse environments
dfe01130  Biosynthesis of antibiotics
dfe01200  Carbon metabolism
dfe01230  Biosynthesis of amino acids
dfe03018  RNA degradation
Module
dfe_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:dfe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dfer_3102
   00030 Pentose phosphate pathway
    Dfer_3102
   00051 Fructose and mannose metabolism
    Dfer_3102
   00052 Galactose metabolism
    Dfer_3102
  09102 Energy metabolism
   00680 Methane metabolism
    Dfer_3102
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    Dfer_3102
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dfe01009]
    Dfer_3102
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:dfe03019]
    Dfer_3102
Enzymes [BR:dfe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Dfer_3102
Protein phosphatases and associated proteins [BR:dfe01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Dfer_3102
Messenger RNA biogenesis [BR:dfe03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Dfer_3102
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: ACT94317
UniProt: C6W6H7
LinkDB All DBs
Position
3791004..3791978
Genome map
AA seq 324 aa AA seqDB search
MKRIGVFTSGGDAPGMNACIRAVVRGACYHGIEVFGIRRGYSGMIAGDVYKMESHSVSNI
VQRGGTILKSARSKEFMTPEGRRKAYDNLQSLGIEGLIAIGGNGTFTGAMIFGNEYGIPT
VGAPGTIDNDLYGTDYTIGFDTAVNTALDAIDRIRDTASSHDRIFFIEVMGRDSGYIAIQ
SGIAGGAELVMVPEVLTPISQVVDTLKQGWSRSKSSSIIIVAEGDEEGSAQEVADKIKVQ
VDENADIRVTTLGHTQRGGTPSAYDRILASRLGLGALEGLIAGQKNVMAGIINNELVYTP
FEDTIRLPKPINEDLLRMVKILSV
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgaattggagtttttacctcaggaggagatgcccctggtatgaacgcctgcatc
cgggcggtagtacgcggagcatgctaccatggtattgaagtatttggaatcagaagagga
tatagcggaatgatcgccggtgacgtctacaagatggagtcgcactcggttagcaatata
gtgcaaagaggaggtaccatcctcaaatcggcacgtagcaaagaattcatgactcccgaa
ggccgcaggaaggcttatgataacttgcagtcgcttggcatcgaagggcttatcgccatt
ggcggtaacggtactttcaccggcgcgatgatcttcggcaacgaatacggcatcccaacc
gtgggcgctccgggaacgatcgataacgatttgtacggaaccgactacacgatcggcttc
gacacggctgtgaacaccgcgctggacgcgatcgaccgtatccgtgacaccgccagctca
cacgaccgtatctttttcatcgaagtaatgggccgcgactcgggctacattgccattcag
tccggtatcgcaggcggtgccgagctcgtgatggttcccgaagtactcacgccgatttcc
caggtggtggataccctcaaacaaggatggagccgttcgaaatcgtcttcaatcattatc
gtggcggaaggcgacgaagaaggaagcgctcaggaagtggccgacaagatcaaagttcag
gtggatgagaacgcggatatccgtgtaaccaccctgggccacacgcagcgcggcggtacg
ccgtccgcttacgaccgcatcctggcaagccgtctcggactgggcgccctggaaggcctc
attgccggacagaaaaacgtcatggccggtatcatcaacaatgaactggtgtacacgcct
ttcgaagacacgatccggttgccgaagccaatcaatgaagacctgctgagaatggtaaaa
atcctgagcgtttaa

DBGET integrated database retrieval system