KEGG   Dyadobacter fermentans: Dfer_3456Help
Entry
Dfer_3456         CDS       T00970                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
dfe  Dyadobacter fermentans
Brite
Translation factors [BR:dfe03012]
 Eukaryotic Type
  Elongation factors
   Dfer_3456
 Prokaryotic Type
   Dfer_3456
Mitochondrial biogenesis [BR:dfe03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Dfer_3456
Exosome [BR:dfe04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Dfer_3456
  Exosomal proteins of breast cancer cells
   Dfer_3456
  Exosomal proteins of colorectal cancer cells
   Dfer_3456
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase Ribosomal_S8 cobW
Motif
Other DBs
NCBI-ProteinID: ACT94666
UniProt: C6VT21
LinkDB All DBs
Position
complement(4232360..4233547)
Genome map
AA seq 395 aa AA seqDB search
MAKETFDRSKPHVNIGTIGHVDHGKTTLTAAITTVLADKGFAQKRDFSSIDNAPEEKERG
ITINTSHVEYQTANRHYAHVDCPGHADYVKNMVTGAAQMDGAIIVVAATDGPMPQTREHI
LLARQVGVPQLVVFMNKVDMVDDPELLELVEMEIRELLSFYEFDGDNIPVIQGSALGGLN
GEPKWVKTIEDLMEAVDTWIPIPPRMTDLPFLMPVEDVFSITGRGTVATGRIERGVINSG
EAVDILGMGAEGLKSVVTGVEMFRKILDRGEAGDNVGLLLRGIDKTDIRRGMVICKPGSV
KPHLHFKGEVYVLSKEEGGRHTPFFNKYRPQFYFRTTDVTGEITLPAGVEMVMPGDNITI
EVKLINKIAMEKGLRFAIREGGRTVGAGQVTEILD
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagagacgtttgaccgctcgaaaccccacgtaaatattggtactatcgggcac
gttgaccacggtaaaactacccttacagcggcgattacaactgtgttggctgataaaggt
tttgcacagaaacgcgacttttcttcaatcgacaatgctcctgaagaaaaagagcgcggt
atcacaatcaacacttctcacgtagaataccagacagccaaccgtcactatgcgcacgtt
gactgcccaggtcacgctgactacgtgaagaacatggtaactggtgctgctcagatggac
ggcgcaatcatcgtggttgctgctactgacggtccaatgccacaaactcgtgagcacatc
cttctggctcgtcaggtaggtgttcctcagcttgttgtgttcatgaacaaagtggacatg
gtggatgatccggaacttcttgaactcgttgagatggagatccgtgagcttcttagcttc
tacgaattcgatggtgacaacattcctgtaatccagggatctgctttgggtggtctgaac
ggcgagcctaagtgggttaaaactatcgaagacctgatggaagctgttgatacctggatt
ccaattcctccacgtatgactgatcttcctttcttgatgcctgttgaagacgtattctcg
atcactggtcgtggtactgttgcaactggtcgtattgagcgtggtgtgatcaactctggc
gaagctgttgatatccttggtatgggtgcagaaggtcttaaatcagtagtaactggtgtt
gagatgttccgcaaaatccttgaccgtggtgaagctggtgacaacgtaggtctccttctc
cgtggtatcgacaaaactgatatccgtcgtggtatggttatctgtaaaccaggctcagtg
aagcctcacttgcacttcaaaggtgaagtttacgtactgtcgaaagaagaaggtggacgt
cacactccattctttaacaaataccgtcctcagttctacttccgtaccactgacgtgaca
ggtgaaattacacttcctgctggtgttgaaatggttatgccaggtgacaacatcactatc
gaagtgaagctgatcaacaaaatcgctatggaaaaaggtcttcgtttcgcgatccgtgaa
ggtggacgtaccgtaggtgctggtcaggtaactgaaattcttgactaa

DBGET integrated database retrieval system