KEGG   Desulfotomaculum ferrireducens: B0537_05840Help
Entry
B0537_05840       CDS       T04823                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
dfg  Desulfotomaculum ferrireducens
Brite
Enzymes [BR:dfg01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     B0537_05840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AQS58648
UniProt: A0A1S6IV25
LinkDB All DBs
Position
1146996..1147592
Genome map
AA seq 198 aa AA seqDB search
MKHELPALPYDYNALEPYYDEQTVRLHHDAHHKAYVDGLNNAEAKLAEAREKGDFALVKH
WERELAFHGSGHILHTMFWENMTPNGGGPATGLVAEEINKFFGSFDIFKKQFSAAAVAVE
GSGWTLLCYNPIFKKLEILTAEKHQNLTQWGVIPLLALDLWEHAYYLKYQNKRAAFVDAW
WNLVNWADVNRRLEACLK
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgaaacacgaattaccagctctaccctatgactataatgctttggagccttattatgat
gagcaaactgtcagattgcaccatgatgcccaccataaagcctatgtggatggtttaaac
aacgctgaggcaaaattggcagaagcccgggaaaagggcgacttcgctttggtgaaacat
tgggaaagggaactggccttccatggttccggccatattttgcataccatgttctgggaa
aacatgactcccaatggcggaggaccggctacagggctggttgccgaagaaattaataaa
ttctttggcagcttcgatatctttaaaaagcaattttctgctgcggcagtggcggtggaa
ggttctggctggactttgctctgctataaccccatttttaagaagttagaaatcctgact
gctgagaagcaccagaacctcacccaatggggcgtgattcccttgctggctttggattta
tgggaacatgcctactacctcaagtaccaaaacaagcgggctgcctttgtggacgcttgg
tggaatctggtcaactgggcagatgtcaaccgcagattagaggcttgccttaagtaa

DBGET integrated database retrieval system