KEGG   Desulfotomaculum ferrireducens: B0537_06520Help
Entry
B0537_06520       CDS       T04823                                 

Definition
(GenBank) alpha-glucan phosphorylase
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
dfg  Desulfotomaculum ferrireducens
Pathway
dfg00500  Starch and sucrose metabolism
dfg01100  Metabolic pathways
dfg01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dfg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    B0537_06520
Enzymes [BR:dfg01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     B0537_06520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3417 Phosphorylase
Motif
Other DBs
NCBI-ProteinID: AQS58766
UniProt: A0A1S6IVG9
LinkDB All DBs
Position
1288303..1290852
Genome map
AA seq 849 aa AA seqDB search
MYFFRTITVNPNVPERIGRLKELSYNLWFSWQPDALELFRRLNEAKWDELKHNPVKMLLE
VNHEDLQRAAQDAEFLELYDKVMLDLDNYINGDTWFKQKYPDLADKTIAYFSAEFGLHES
LPIYSGGLGVLAGDHCKAASDIGLPLVGVGLLYKQGYFTQQINREGWQEAHYPYQNYNQM
PVRSAVDHEGKEVIVSVELPGREIYLKVWQIQVGRIFIYLMDADITMNSEQDRQLTAQLY
GGDKDTRISQEMILGIGGVRALRRLGINPVAWHINEGHAAFLCLERLKELVQAGVPLAAA
REAVRASTIFTTHTPVPAGHDVFEIDKVDFYLHRYYNLLGIDKSSFMQFGYDHQRQGFNM
TILAMNFAAYCNGVSKLHGEVSRKMFHYLYENIPVEEVPITSVTNGIHTLTWIAHELRQL
LDAQLDPAWKTDISNHSIWQGVDNIPDQELWDMHKNLKKKAIQYVRQSISNQMVRNQEAA
EDIDSVAEYLNPDAFTIGFARRFATYKRATLLFRDKERLARLFTHPERPVQIIFAGKAHP
ADRPGQELIKEIFELSRQEPFRGKIIFIENYDMDVARHLVQGVDMWLNTPRWPMEASGTS
GMKAAANGVINCSVLDGWWPEAYQPDNGFAIGKQTGYRTDDEQDMDDAYHLYSILEEQII
PTYYQQVDGYPQEWLRMMKNCIKSIAPQFSTERMVKEYTERFYSDAIRRGEKFAADHFRL
ATEVHDFKRYIKDNWHHIAIKNVQINGDNESELKVGDSLYLTANVYLGPIQPKDVKVEVV
YGCEGDHTLEQIKTAPLNHEGTLEEGIHQYRGGFTLDQGTCGFTVRVRPEHPLFATKFEL
PLTSWAHSF
NT seq 2550 nt NT seq  +upstreamnt  +downstreamnt
atgtatttttttcgtaccattaccgttaaccccaatgtaccggagagaattggtcggctc
aaagagttatcctataacctttggttcagttggcaaccagatgccctggaactatttcgc
agactcaatgaggcaaagtgggatgagttaaaacacaatccggttaaaatgctgctagag
gttaaccatgaggatttacagagggctgcccaggatgccgagtttctggagctctacgat
aaagtaatgctggacttagataattatataaatggcgacacctggttcaaacaaaaatat
cctgatctggcagacaagaccatcgcctatttttccgcagaatttggcctccacgaatca
ttgcccatctattccgggggactgggggttctggccggtgaccattgtaaagcagccagt
gacattggtttacctttggttggtgtaggactgttgtacaaacagggttactttacccaa
cagataaaccgagagggctggcaagaggctcactatccttatcaaaactacaaccaaatg
cccgttagatctgccgtggaccacgaaggaaaagaagtaattgtttcggtggaattgccc
ggcagggagatctatctgaaggtttggcaaattcaagttggccgcattttcatttattta
atggatgcggatatcaccatgaatagtgaacaggacaggcaattaaccgcccaactttac
ggtggagataaggacacaagaatttcccaagaaatgattctgggtattggtggggtaagg
gccttacgcaggctgggtattaatcccgtggcttggcatatcaatgaaggacatgccgcc
ttcctatgtttggaacgcctcaaggaattagtgcaggcaggggtacccttggcggcagcc
agagaggctgtacgggccagtactatttttaccacccatacacctgttccggcaggtcat
gatgtatttgagatagataaggtggatttctatttacatcgctactacaatctgctgggc
atagataagagtagttttatgcagtttggctatgatcaccagcggcaaggctttaacatg
actattttagccatgaattttgcggcctactgcaatggtgtaagtaagctgcatggtgaa
gtcagcagaaaaatgtttcattatttatatgagaatattcccgttgaagaggtacccata
acatcggttaccaacggcattcataccttaacctggattgctcacgagctgaggcagttg
ttggatgcccagcttgacccggcctggaaaactgacatcagtaatcacagcatttggcaa
ggggtagataatatacccgatcaagaactctgggatatgcataagaatttaaagaagaag
gccattcaatatgttagacaatccatcagtaaccaaatggtccgtaatcaagaagcagcc
gaggatattgacagtgtggcagaatatttaaaccccgatgcttttaccatcggttttgcc
agacgctttgctacctataaaagagctaccctactgttccgtgataaagaaagattagcc
cgactttttacccatccggaaagaccggtgcagattatctttgccggtaaagcacatccc
gccgatcgcccggggcaggaattaatcaaggagatttttgagttatctcggcaggaaccc
tttcggggcaagataatttttatagaaaactatgatatggacgtggccagacacctggtg
caaggggttgacatgtggctaaacacacctcgctggcccatggaagccagtggtaccagt
ggcatgaaggccgcagccaacggagtgataaattgcagtgtactggatggttggtggccg
gaagcctatcaaccggataatggatttgccattggtaaacaaaccggttatcgcaccgat
gatgaacaggatatggatgacgcttatcacctctactccattctagaggagcaaattatc
ccaacttattaccaacaggtggatggatacccccaggaatggctcaggatgatgaaaaac
tgtattaagagcattgctccgcagtttagtaccgaaaggatggtaaaggaatacaccgag
cgcttctatagcgacgctattagacggggggaaaaatttgctgccgatcactttcgcctg
gctacagaagtccatgactttaagagatatatcaaagataattggcaccatatagctata
aaaaatgtacagatcaatggtgataatgaaagtgaattaaaggtaggagattccctctat
ctgacagccaatgtatatttggggccgatccaacctaaagatgtcaaagtagaagtggta
tatggttgtgaaggggaccataccttggaacaaattaagacagccccccttaatcatgaa
ggaacattggaggaaggcattcaccaatatcgaggtggttttaccctggatcagggaacc
tgtggctttacagtgcgagttcgaccggaacatccgctctttgccacaaaatttgaatta
cctctgaccagttgggcccatagtttttaa

DBGET integrated database retrieval system