KEGG   Desulfotomaculum ferrireducens: B0537_06695Help
Entry
B0537_06695       CDS       T04823                                 

Definition
(GenBank) spore coat protein
  KO
K06330  spore coat protein H
Organism
dfg  Desulfotomaculum ferrireducens
Brite
KEGG Orthology (KO) [BR:dfg00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    B0537_06695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CotH HipA_C
Motif
Other DBs
NCBI-ProteinID: AQS58796
UniProt: A0A1S6IVK5
LinkDB All DBs
Position
complement(1329814..1330905)
Genome map
AA seq 363 aa AA seqDB search
MGDKITLPTYSLFIKPQDLRQLRSDIWSNEHIPAKLKVGHSTYHIEIAYRGALTRDLPKK
SFHINFIKPGTFQGGREIHLNAEYLDPSLIRNKLSLDFFKSLGVLSPEAKYVLLSLNGTV
LGIYLQLESVDDLFLKKRGLPQGPIIYAHNDDANFSFLDPDTEEIKESLFDGYKLKCGQE
ADEDRLCEMIYKINTLSRSDFSQEIRRYMDIEKYLRWLAGVVCTQNYDGFIQNYALYANP
TTNLYEMIPWDYDGTWGRDCHGQVMEPDYFPIQGANTLTARLLDIDEFRHRYRNLLEEIL
ATLFTPEFLEPQITANYQLLRPHIRQDPHKRKAVAKFEAEPSFILDFISKRNSYLKNQLA
TLL
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgggtgataaaataacgctgccaacctattcccttttcataaagccccaggatctccgg
caactgcgcagtgatatttggagcaatgagcatattccagctaaactcaaggtgggtcac
agcacttatcatattgagatcgcctatcgaggagcacttacccgggatttaccgaaaaaa
tcctttcatataaactttattaagcctggaacctttcaaggaggcagagaaattcattta
aatgctgagtacctggacccttcgttaatacgcaacaaattatccttggacttttttaag
agtctaggcgtcctgagccccgaggccaaatatgttctactgtccttaaatgggacagtc
ctgggcatctatttgcaactggaatcagtggatgacctgtttttaaagaagcggggttta
cctcagggacccattatttatgcccataatgatgatgccaacttttcctttctcgaccct
gataccgaagaaattaaggagtccctctttgacggctataaattaaagtgcggccaggaa
gcagatgaagaccggctctgtgaaatgatttataaaataaataccctgtcgcgttcagat
tttagccaagaaatacgccggtacatggatatagaaaagtacttgcgttggttagccggg
gtagtttgtacgcaaaactatgatggatttattcaaaattacgccctctatgctaacccc
accaccaacttgtatgagatgataccctgggattatgatggaacctggggacgggattgt
catgggcaagtgatggagcctgattactttcctattcagggggccaataccctcacagca
cggttgctggatatagatgaatttcgacaccgctaccgtaatttgctggaggaaattttg
gctaccctcttcaccccggagttcctggaaccacaaattacagccaactatcaactactt
cgccctcatattaggcaagatccccataagcggaaagctgtggcaaaattcgaggcagaa
ccatcctttattcttgattttattagcaagagaaacagctacctaaaaaatcaattggct
actctcctgtaa

DBGET integrated database retrieval system