KEGG   Desulfotomaculum ferrireducens: B0537_07055Help
Entry
B0537_07055       CDS       T04823                                 

Definition
(GenBank) sn-glycerol-3-phosphate dehydrogenase subunit A
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
dfg  Desulfotomaculum ferrireducens
Pathway
dfg00564  Glycerophospholipid metabolism
dfg01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dfg00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    B0537_07055
Enzymes [BR:dfg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     B0537_07055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Pyr_redox_2 Fer2_BFD FAD_binding_2 FAD_binding_3 FAD_oxidored ThiF
Motif
Other DBs
NCBI-ProteinID: AQS58864
UniProt: A0A1S6IVQ9
LinkDB All DBs
Position
1420917..1422521
Genome map
AA seq 534 aa AA seqDB search
MTAETVQVVVIGGGATGTGILRDLALRGISAILVEQGDLAHGTSSRFHGLLHSGARYAVK
DKEAARECLEENMILRRIAPNCVENIGGLFVQLPEDDPAYAEQWLVACAEAGIKTEEMDL
QELRRNTPILNAQVTRAFKVPDCAVDGFRVLWSNVNSARRHGARLLTYHRVIGIRQSNGQ
VIGVELVNELTGEKKYIACDMIINAAGAWAGEVAALAGLEINVIKDKGTLVAYNHRLTKQ
IVNRLRPPGDGDIFVPHGTITIFGTTSVTVNDAACTKPGDSEVAELIKTGQDMIPELENY
RLIRAFAGVRPLYQEGNSAGGRDVTRNFALLDHQEKDGLQGFISIVGGKFTTFRLMAEKT
VDLAAKRLGVTAACRTAEEPLAAPVDPALLERGKRVFGVPGAKKAADRLGDSFAKVVEEA
ERNPDQRKIFCECEVVSLAEIAHVAQDGDSFTLGDIRRKTRMGMGTCQGTFCSYRTLGAL
SGYPQFAGNHKDYLTKFLQKRWKGIRPVMWGQQLREAQLSSAIYCSLFGLERMK
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgacagcagagacagttcaggtggtggtaattggcggaggtgccaccggtacaggaatt
ctccgggatcttgccctcaggggtatatccgctatcctggtagagcaaggagatttggcc
catgggaccagttcaaggtttcatggtttgttacacagtggcgcacgctacgcggtgaag
gacaaggaagcggccagggagtgtctggaggaaaacatgatcctgcgtcgtatcgccccc
aactgcgtggagaatattggtggtctttttgttcagttaccagaggatgatcctgcctat
gccgagcagtggctggttgcctgtgccgaggctggcattaaaacagaggaaatggacctt
caggaattacgtcgcaatacccctattttaaatgcccaggtaaccagggcttttaaggtt
ccagattgcgcagtggacggtttccgggttttgtggagcaatgttaattctgctcgccgt
catggtgcacgattacttacctatcaccgtgtcattgggattcgtcaaagtaatggtcaa
gttataggggtagaactggttaatgaactcaccggtgagaagaaatatattgcctgcgat
atgattatcaatgctgccggagcctgggcgggagaagtggctgccctggccggactggaa
ataaatgttattaaagataaagggaccctggtggcctataaccacaggttgaccaagcag
atagtaaatcgactgcgcccgcctggggatggggatatatttgtaccccatggtaccatt
actatctttggtaccacctcagtaacggtaaatgacgccgcctgcaccaaacccggtgac
agcgaagtagcggaactaataaaaactggtcaagacatgatacccgaattagagaattac
cgcctgatccgagcctttgccggtgtacgccccctctaccaggaggggaacagtgctggg
ggcagagatgttacgagaaattttgcccttctagatcaccaggaaaaagacggcttgcag
ggcttcataagtattgtgggcgggaaatttaccacctttcgcttaatggctgaaaaaaca
gtggatttagcggctaaacgattaggtgttaccgctgcctgtcggacagccgaggaaccc
ttagctgcgcctgtagaccctgctttgttggaacggggtaaaagggtttttggagttcct
ggtgccaagaaggccgccgaccgcttgggagatagttttgccaaggtggtagaggaggca
gaaaggaatcctgatcaacgtaagatcttctgtgaatgcgaagttgtcagcctggccgaa
attgcccacgtggcccaggacggcgatagcttcaccctgggagatatccgtcgtaaaacc
agaatgggtatgggaacctgccagggaaccttttgcagctatcgcaccctgggagcttta
agtggctatccacagtttgcgggcaaccataaggactatctcactaaatttttgcaaaag
cgctggaagggaatcagacctgtcatgtggggtcagcaactgagagaggcccagttatcc
tctgcaatatattgttcattatttggtttggagagaatgaaatga

DBGET integrated database retrieval system