KEGG   Desulfotomaculum ferrireducens: B0537_07720Help
Entry
B0537_07720       CDS       T04823                                 

Definition
(GenBank) superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
dfg  Desulfotomaculum ferrireducens
Brite
Enzymes [BR:dfg01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     B0537_07720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: AQS60543
UniProt: A0A1S6J0J3
LinkDB All DBs
Position
complement(1567757..1568227)
Genome map
AA seq 156 aa AA seqDB search
MMHCNMAVAEIHGGPLAPQLTGLVYFQDVPGGTWVAAEIYGLPPYQPAQNGQAPIGPHGF
HMHVNGTCAIGDPANPFQAAGEHWNPYQQPHGNHAGDFPVLFSNNGYAKMFFFTNKFTVS
QAIGHSVIIHQSPDDYRTQPAGDAGKRLACGVVRAV
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgatgcactgtaacatggccgtagccgagatacatggtggtcctctggcaccacagcta
actggcttggtatatttccaagacgtacctgggggaacttgggtagccgcagaaatttat
ggcttacccccctatcaacctgcccaaaacggccaggcccccatcggcccccatggtttt
cacatgcacgtcaatggtacttgtgccatcggcgatcccgctaatccctttcaagcagcg
ggagaacattggaatccatatcagcaaccccacggcaatcatgccggtgattttcctgta
ctgttttctaacaacggttatgccaaaatgtttttctttactaataaattcaccgtatcc
caggccattggtcactcggtaatcatccatcaaagcccggatgattaccgaactcaacct
gccggtgacgctggtaaacgactggcctgtggagttgttcgtgccgtgtaa

DBGET integrated database retrieval system