KEGG   Desulfotomaculum ferrireducens: B0537_08775Help
Entry
B0537_08775       CDS       T04823                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
dfg  Desulfotomaculum ferrireducens
Pathway
dfg00473  D-Alanine metabolism
dfg00550  Peptidoglycan biosynthesis
dfg01100  Metabolic pathways
dfg01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:dfg00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    B0537_08775
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    B0537_08775
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    B0537_08775
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:dfg01011]
    B0537_08775
Enzymes [BR:dfg01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     B0537_08775
Peptidoglycan biosynthesis and degradation proteins [BR:dfg01011]
 Precursor biosynthesis
  Amino acid ligase
   B0537_08775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp CPSase_L_D2 GARS_A RimK ATP-grasp_4 ATP-grasp_2
Motif
Other DBs
NCBI-ProteinID: AQS59163
UniProt: A0A1S6IWL6
LinkDB All DBs
Position
1792939..1793877
Genome map
AA seq 312 aa AA seqDB search
MTLKIGVIYGGRSAEREVSLRSGEAVYQALLAAGYSNVVKIDAKENLVEQLKTNNIDLAF
LALHGKYGEDGTIQGLLEMLDIPYTGSGVLASAMAISKITSKKIFLLEGIPTPSFTVVTR
REVNKHGLAAASARVLQEVGVPAVVKANTQGSTIGITFVHSADKMSEAITSALNYDQDVL
IEEFITGMEVTASVLGNEDPVALPLIEITSAKGIYDYEAKYTPGMSDHIIPPRLPEEVQR
KIESLAVKAYMALGCRGLGRVDFMVTESAIYALEINTLPGMTATSLFPDAARYAGIEFPQ
LVDRLVKLALER
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
ttgacattaaaaataggggtgatttacggtggccgatccgcggagcgggaggtatctctc
agaagcggtgaagctgtttaccaggccttattagctgcgggctacagtaatgttgtaaaa
atagatgccaaggaaaatctagttgagcagcttaagaccaataatatcgacttggctttt
ctggctttacatggtaaatatggtgaggatggaactatccaaggtttattggaaatgttg
gatattccctatacaggtagtggcgttttagccagcgctatggccatcagcaagattacc
tccaaaaaaatattcctattagagggcattcccacaccaagttttaccgtggtaacccgg
cgggaagttaataaacatggactggcagcagcgtcagccagggtcctgcaagaggttggg
gtgccggcggtggtaaaagccaatacccagggttctaccattggcattacctttgtccat
agtgcagataaaatgtctgaggccataacttcagccttaaattatgaccaggatgtatta
atagaagaatttattaccggcatggaagtaactgcttctgtgctgggcaatgaagatccg
gtggctttaccactaatagaaatcacttccgccaaaggtatctatgactacgaggctaaa
tatacacctggcatgagtgaccacatcataccaccaagacttccggaagaagtgcaaaga
aaaatagaaagcttggctgtcaaggcctatatggctttaggttgccgtggcttaggccgg
gttgattttatggttacggaatccgctatatatgctttggagattaatactttacctggc
atgacggccaccagtctctttcctgacgcggcccgttatgcaggtatagaattcccacag
ttggttgaccgtttggtaaaattagctttggaacggtaa

DBGET integrated database retrieval system