KEGG   Desulfotomaculum ferrireducens: B0537_09225Help
Entry
B0537_09225       CDS       T04823                                 

Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
dfg  Desulfotomaculum ferrireducens
Pathway
dfg00020  Citrate cycle (TCA cycle)
dfg00190  Oxidative phosphorylation
dfg00650  Butanoate metabolism
dfg00720  Carbon fixation pathways in prokaryotes
dfg01100  Metabolic pathways
dfg01110  Biosynthesis of secondary metabolites
dfg01120  Microbial metabolism in diverse environments
dfg01130  Biosynthesis of antibiotics
dfg01200  Carbon metabolism
Module
dfg_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:dfg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    B0537_09225
   00650 Butanoate metabolism
    B0537_09225
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    B0537_09225
   00720 Carbon fixation pathways in prokaryotes
    B0537_09225
Enzymes [BR:dfg01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     B0537_09225
    1.3.5.4  fumarate reductase (quinol)
     B0537_09225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_10 Fer4_8 Fer4_9 Fer4_16 Fer4_17 Fer4_18 Fer4_7 Fer4
Motif
Other DBs
NCBI-ProteinID: AQS59246
UniProt: A0A1S6IWU5
LinkDB All DBs
Position
complement(1894516..1895265)
Genome map
AA seq 249 aa AA seqDB search
MSKEFVSLKIKRQAAPEATAYWEEFKIPYKPKMNVITLLMEIQKNPINAKGERTTPVVWE
CNCLEEVCGACTMIINGQARQACSALVDQLQQPITLEPLSKFPLVRDLMVDRSKMFDNLK
KVKAWIPIDGTYDLGPGPRMSQKVQEEHYPISRCMTCGCCMEACPNVNHKSPFMGPAPLA
QVKLFNAHPTGAMNREERLDAIMGVGGVTDCGNAQNCIKVCPKQIPLTKSIAQLNRDTTL
HGIKRWLGR
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
gtgagcaaggagtttgtttccttaaaaataaaaagacaggctgctccggaggcaactgcc
tattgggaagaatttaaaataccctataaacccaaaatgaatgtgattacactcttaatg
gaaattcaaaaaaatccgatcaatgccaagggggaaagaacaactcctgtggtctgggag
tgcaattgtttggaggaggtatgtggcgcctgtaccatgattattaacggccaagccagg
caggcctgttctgccttagtggatcaactacagcagcccattaccttggaacctctgagt
aaatttcccctggtgcgggatctgatggtggaccgcagtaagatgtttgataatctgaaa
aaggtaaaggcctggattcccattgacggtacttacgatcttggccccggtcctcgtatg
tctcagaaggttcaggaggaacattaccctatttcccgctgcatgacctgtggttgctgc
atggaggcttgtcccaatgttaaccataaatccccatttatgggaccggcgccgctggct
caggtaaagctgtttaatgctcatcccacgggagccatgaacagggaagaacgtctggat
gccattatgggtgtgggaggggttactgactgcggcaatgcccaaaattgcattaaggtt
tgccccaaacaaatacctttaaccaaatccattgcccagcttaaccgggatactaccttg
catggcatcaaaagatggttaggtcgctaa

DBGET integrated database retrieval system