KEGG   Desulfotomaculum ferrireducens: B0537_09230Help
Entry
B0537_09230       CDS       T04823                                 

Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
dfg  Desulfotomaculum ferrireducens
Pathway
dfg00020  Citrate cycle (TCA cycle)
dfg00190  Oxidative phosphorylation
dfg00650  Butanoate metabolism
dfg00720  Carbon fixation pathways in prokaryotes
dfg01100  Metabolic pathways
dfg01110  Biosynthesis of secondary metabolites
dfg01120  Microbial metabolism in diverse environments
dfg01130  Biosynthesis of antibiotics
dfg01200  Carbon metabolism
Module
dfg_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:dfg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    B0537_09230
   00650 Butanoate metabolism
    B0537_09230
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    B0537_09230
   00720 Carbon fixation pathways in prokaryotes
    B0537_09230
Enzymes [BR:dfg01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     B0537_09230
    1.3.5.4  fumarate reductase (quinol)
     B0537_09230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA HI0933_like FAD_oxidored FAD_binding_3 NAD_binding_8 AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: AQS59247
UniProt: A0A1S6IWV1
LinkDB All DBs
Position
complement(1895262..1897019)
Genome map
AA seq 585 aa AA seqDB search
MQNTIIIVGGGLAGLMATIKVAEMGIKVKLFSLVPVKRSHSVCAQGGINGAVNTKGEGDS
PLIHFDDTIYGGDFLANQPPVKDMCEAAPAIINLMDRMGVMFNRTPEGLLDFRRFGGSKH
HRTAFAGATTGQQLLYALDEQVRRFEVAGLVEKYEGWDLLSVILDDERICRGITAQHLKT
MEIHSFPADAVILATGGCGIIFGKSTNSTINTGAAASAVYQQGVYYANGEMIQIHPTAIP
GDDKLRLMSESARGEGGRVWTYKDGKPWYFLEEWYPAYGNLVPRDIATRAIYKVCYELKL
GIDGQNMVYLDVSHINRDILDKKLAGILEIYERFVGDDPRKVPMRIFPAVHYSMGGLWVD
YQQMTNIPGLFACGECEYQYHGANRLGANSLLSAIYGGMITGPNAVRYINSLQKSCRDLP
SSVFDRELQRQQALMDKIYQMDGQENVYQLHEELGKWMTENVTVVRYNKKLQETDNKIQE
LLQRWHHIKLTDKGKWANQEAAFTRHLWHMLQLARVITLGALNRNESRGAHYKPEFPERD
DVNWLKTTKASYSAEGPVFSYEEVDISLIKPRPRRYDVDKEATNK
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaataccattattattgtcggtgggggattggcaggactaatggcaaccattaag
gttgcggaaatgggtattaaagtaaaattattttccttggtgccggtaaaacgctcccac
tcggtgtgtgcccagggaggtattaacggagcagtaaataccaaaggggagggagattcc
cctctcatccactttgatgacaccatttatggcggagattttttagctaatcaacccccg
gtaaaggacatgtgtgaggccgctccagccattatcaatttaatggatcgtatgggcgtg
atgttcaatcgtacccctgagggactgcttgattttcggcgttttgggggcagcaagcat
caccgcactgcctttgccggagccaccacaggtcagcaactgctctatgccctggatgaa
caggtcaggcgttttgaagtggcgggactggtggagaaatacgagggttgggatttacta
tctgttattttggatgatgaaagaatctgccggggtatcaccgcacagcatctaaaaact
atggaaattcactctttccctgcggatgcggtaatcttggccaccggtggctgcggtatt
atctttgggaaaagcaccaactctaccatcaacaccggtgccgccgccagcgcagtttac
cagcagggagtctattatgccaacggggaaatgattcaaatacaccccacagccattccc
ggagatgataagttaagactgatgagtgaatctgcccggggcgaagggggtagagtctgg
acctataaggatggcaagccctggtactttttagaggaatggtacccggcatatggtaac
ttagtaccccgtgatattgccacacgggccatttataaggtttgctatgaactgaaactg
ggtatagatgggcaaaatatggtatatctggatgtatcccatattaatcgggatattctg
gataagaagctggctgggatcttagaaatttacgagcgttttgttggcgatgatccgcgc
aaggtacctatgcgaatctttcctgcggttcactactccatgggtgggctttgggttgac
tatcaacaaatgaccaatattcctggtttgtttgcctgtggagaatgcgagtaccagtat
catggggctaaccgcttaggtgccaattcgctgttatctgccatctacggtggtatgata
accggtcccaatgccgtcaggtatattaattccctccagaagagctgccgggatttacca
agctctgtgtttgaccgagaactgcaacggcagcaggctttgatggataaaatttaccaa
atggacggtcaagaaaatgtttaccagcttcacgaagagttgggtaagtggatgaccgag
aatgtgacagtggttcgctataacaaaaagctacaggaaacagataataaaattcaggaa
ctcctgcaaagatggcatcatatcaaacttacggataaaggtaagtgggccaaccaggaa
gcggcattcacccgccatttatggcatatgctgcaactggccagggtgataaccctgggg
gctcttaaccgtaatgaaagcagaggggcccattataaaccagagtttcccgagcgggat
gatgttaattggctaaaaaccaccaaggccagctattccgcagaggggccggtatttagc
tatgaagaagtagatatatccctcattaaaccaaggcctcggagatatgatgtggataag
gaggcgacaaacaagtga

DBGET integrated database retrieval system