KEGG   Desulfotomaculum ferrireducens: B0537_12000Help
Entry
B0537_12000       CDS       T04823                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
dfg  Desulfotomaculum ferrireducens
Pathway
dfg00010  Glycolysis / Gluconeogenesis
dfg00030  Pentose phosphate pathway
dfg00051  Fructose and mannose metabolism
dfg00052  Galactose metabolism
dfg00680  Methane metabolism
dfg01100  Metabolic pathways
dfg01110  Biosynthesis of secondary metabolites
dfg01120  Microbial metabolism in diverse environments
dfg01130  Biosynthesis of antibiotics
dfg01200  Carbon metabolism
dfg01230  Biosynthesis of amino acids
dfg03018  RNA degradation
Module
dfg_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:dfg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    B0537_12000
   00030 Pentose phosphate pathway
    B0537_12000
   00051 Fructose and mannose metabolism
    B0537_12000
   00052 Galactose metabolism
    B0537_12000
  09102 Energy metabolism
   00680 Methane metabolism
    B0537_12000
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    B0537_12000
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:dfg01009]
    B0537_12000
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:dfg03019]
    B0537_12000
Enzymes [BR:dfg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     B0537_12000
Protein phosphatases and associated proteins [BR:dfg01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     B0537_12000
Messenger RNA biogenesis [BR:dfg03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     B0537_12000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase
Motif
Other DBs
NCBI-ProteinID: AQS59735
UniProt: A0A1S6IY69
LinkDB All DBs
Position
complement(2456779..2457741)
Genome map
AA seq 320 aa AA seqDB search
MQRIGVLTSGGDASGMNSCIRAVVRKAIYHGLEVIGINRGYSGFVDADMGPMNLGSVADI
IGKGGTILHTARSKRFMTKEGRALAYENVQRFGIQGLVVIGGDGSFTGANIFQQEYGLPV
ICVPGTIDNDIAGTDYTIGFDTAVNNVVDAINKIRDTATSHERTFVIEVMGRHAGHIALA
AGLAGGAESILIPEIPYNIDDICKKLLSGIRRGKLHSVILVAEGAASGIDIGQKIKELTG
FDTKVTILGHLQRGGSPSSFDRILAARLGAKAVELLMAGETNKMVGMKAGEIVATDLAEV
IGKSSPINKEMYELAKILSI
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgcagaggattggtgtattgacaagtggtggcgatgcctcaggcatgaactcctgtatt
cgtgcggttgtccgtaaagctatttaccatggcttggaggttatcggtattaaccgaggt
tacagtggctttgtggatgctgacatgggtccgatgaatttaggctcggtggccgatatc
attggtaagggaggaactatactacatactgccagatcaaaacgttttatgactaaagag
ggcagagccctggcctatgagaatgtacaacggtttggtattcaggggttagtggtcatt
ggcggagatggttcctttaccggggccaatatttttcaacaggaatatggcctgccggtt
atttgtgtgccgggaaccattgacaatgacatagccggtacagattataccattggcttt
gataccgcagttaataatgtggtggacgccattaataaaatccgtgataccgccacctcc
catgaacgtacctttgtcattgaggtgatgggtcgtcatgccggccatattgccctggcc
gcaggcctggccggtggtgccgagagtattctcattcctgagataccttataatatagat
gatatttgcaaaaaattactcagcggcattaggagaggtaaactgcattccgttatcctg
gtggccgaaggtgcggccagtggcattgacatcggccagaaaatcaaggagctcactggt
tttgataccaaggttaccatcctgggtcatttgcaacggggaggtagccccagctccttt
gaccggattctggcagcccggttaggagccaaggcagtggaattgctcatggccggggaa
actaataaaatggtgggcatgaaggcaggagagatagtcgctaccgatttagcggaggtt
attggtaagtccagcccaattaataaggaaatgtacgaattagctaaaattctctcgatt
taa

DBGET integrated database retrieval system