KEGG   Desulfotomaculum ferrireducens: B0537_14200Help
Entry
B0537_14200       CDS       T04823                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
dfg  Desulfotomaculum ferrireducens
Pathway
dfg00473  D-Alanine metabolism
dfg01100  Metabolic pathways
dfg01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:dfg00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    B0537_14200
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    B0537_14200
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:dfg01011]
    B0537_14200
Enzymes [BR:dfg01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     B0537_14200
Peptidoglycan biosynthesis and degradation proteins [BR:dfg01011]
 Precursor biosynthesis
  Racemase
   B0537_14200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C DUF2181
Motif
Other DBs
NCBI-ProteinID: AQS60126
UniProt: A0A1S6IZD2
LinkDB All DBs
Position
complement(2890721..2891842)
Genome map
AA seq 373 aa AA seqDB search
MAEPIWAEINLANIRHNIREVRRLVGAEREIMAVVKANGYGHGAVQVAKAVLAAGANRLA
VARLCEALTLREAGITAPILIFGYLSKEQMAQALQQQLTITIYRLDMAEQLAELAQEAGK
SVRIHLKVDTGMGRLGFCEGEQGIREIEQICSLPGLICEGIYTHFATADEKDKTYTKWQL
DRFLSLLHVLEQRGITFPLRHAANSAAIIDFPAAYLDMVRPGIMIYGLYPSAEVEQHKVK
LLPAMSLKARITHLKKVTSGTKISYGCTYVTPEDTVIASLPLGYADGYPRLLSSRGQVLI
KGQRAPVVGRVCMDQCMVDVGKIPDVKVHDEVIIFGQGDQQSLPVEEVADWSGTINYEVV
CWIGSRVPRFYID
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaccaatttgggcagaaattaacctggcaaatattcgtcataatataagggaa
gtaagaagattggttggggcggaaagggaaattatggctgtggtcaaggccaatggctat
ggtcacggggcggttcaggtggcaaaggccgtcctggcggctggggccaatcggctggcc
gtggccagactctgtgaagcccttaccttacgagaggcaggcattactgctcccatctta
atctttggttatttatcaaaggagcaaatggcccaggcgcttcagcagcagctaaccatt
accatttatcgcctggatatggcagagcagttggcagaactggctcaagaggccggtaaa
tcggtcaggatacatctcaaggtggacaccggtatgggacgcctgggtttttgcgaggga
gaacagggaattagggagatcgaacagatttgttccctgcccggtttgatctgcgagggt
atttatacccattttgcaacagcggatgaaaaggataaaacctataccaaatggcaactg
gatcgttttttatccctcctccatgtcctagagcagcggggtattacctttcccctgcgt
catgccgccaacagtgcagcgattattgattttcccgcagcttacctggacatggtacgg
ccgggtattatgatttatggcttatacccctcggcagaggtggagcagcataaagtaaaa
ctgttgccggccatgagcctcaaggcacggattacccatttgaagaaagtaaccagtggt
actaaaatcagttatggttgtacctatgttacaccggaggatacggttattgcctcactg
ccattgggttatgctgatggctacccccgcttgctttcctcccggggacaagtattaatc
aagggacagagggcccctgtggtggggcgagtttgcatggatcaatgcatggtggatgtg
ggcaaaattcctgatgtcaaggtgcatgatgaggtaattatttttggccaaggagatcag
cagagtctaccggtggaagaagtagctgactggtccggcaccattaactacgaagtggta
tgctggataggtagccgtgtgccacgtttctatatcgactga

DBGET integrated database retrieval system