KEGG   Desulfovibrio ferrophilus: DFE_1863Help
Entry
DFE_1863          CDS       T05829                                 

Gene name
sodB
Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
dfl  Desulfovibrio ferrophilus
Brite
Enzymes [BR:dfl01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     DFE_1863 (sodB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: BBD08589
UniProt: A0A2Z6AZC1
LinkDB All DBs
Position
complement(1988655..1989245)
Genome map
AA seq 196 aa AA seqDB search
MSITLPQLPFAKDALAPHISANTLDFHHGKHHNLYVTNVNNMIEGTDLAGASLEDIVKKT
AGDASKAGLFNNAAQVWNHTFFWNSMKPGGGGAPTGAIASRIETDFGGYDKFAEAFKTAG
MTQFGSGWAWLVEKGGKLEIMKTPNAELPLALGIKPLLTCDVWEHAYYLDYQNRRADFLA
AFLAHLVNWDFANANL
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgagtataactctgccccaattgccttttgctaaggatgccttggcgccacacatcagt
gcaaacacgttggattttcatcatggaaaacatcacaatctttatgtcaccaacgtcaac
aacatgattgaaggcaccgatctggcgggagcgtcccttgaggacatcgttaagaaaaca
gctggcgatgcctccaaggctgggctgttcaacaatgcagctcaggtctggaaccacacc
tttttctggaactccatgaaaccaggggggggcggcgctcccaccggggccatcgcttcg
cgtatcgagaccgatttcggtggctacgacaagtttgccgaagccttcaagaccgctgga
atgacccagttcggcagtggctgggcctggttggtggagaagggtgggaagctggaaatc
atgaaaactcccaatgcggaactccccctggcgctaggcatcaagccgctgttaacctgc
gacgtctgggaacacgcctactacctggattaccagaaccgccgtgcggactttttggca
gccttcctggcgcaccttgtgaactgggattttgccaacgcgaatctgtaa

DBGET integrated database retrieval system