KEGG   Dickeya fangzhongdai: CVE23_00885Help
Entry
CVE23_00885       CDS       T05277                                 

Definition
(GenBank) L-threonine 3-dehydrogenase
  KO
K00060  threonine 3-dehydrogenase [EC:1.1.1.103]
Organism
dfn  Dickeya fangzhongdai
Pathway
dfn00260  Glycine, serine and threonine metabolism
dfn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dfn00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CVE23_00885
Enzymes [BR:dfn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.103  L-threonine 3-dehydrogenase
     CVE23_00885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 FAD_binding_3 AlaDh_PNT_C Pyr_redox_2 HI0933_like Pyr_redox Pyr_redox_3 FMN_dh FAD_oxidored DUF1272
Motif
Other DBs
NCBI-ProteinID: ATZ92662
UniProt: A0A2K8QGU4
LinkDB All DBs
Position
194460..195482
Genome map
AA seq 340 aa AA seqDB search
MKALAKLRPEPGIWLTDVSAPEPGHNDVMIKIRKTAICGTDVHIYNWDAWSQKTIPVPMV
VGHEYVGEIVAIGQEVEGFRIGDRVSGEGHITCGYCRNCRAGRRHLCRNTSGVGVNRPGA
FAEYLVIPAYNAFRLPAAIPDDIAAIFDPFGNAVHTALAFDLVGEDVLVSGAGPIGVMAA
AVCRHVGARHVVITDVNDYRLALARRMGVNRAVNVARESLTDVMRELGMTEGFDVGLEMS
GAPAALRTLLSVMNHGGRIAMLGIPPEAVSVDWSDIIFKGLVIKGIYGREMFETWYKMAA
LIQSGLDLSPIITHRYAIDDFQNGFDVMRSGQSGKVVLSW
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgctggcgaaactgcgcccggaaccgggcatctggctgactgacgtttccgcg
ccggaaccgggccacaacgatgtgatgatcaaaatccgtaaaaccgccatttgcggcacc
gacgtgcatatctacaactgggatgcgtggtcgcagaaaaccatcccggtgccgatggtg
gtcgggcatgagtatgtcggcgagatcgtggcgatagggcaggaagtggaagggttcagg
attggcgatcgggtgtcgggcgaagggcatatcacctgcggctattgccgtaactgccgc
gccggacgccgtcatttgtgccgcaatacctccggcgtcggtgtcaaccggccgggcgct
ttcgccgagtacctggtgattccggcgtataacgcgttccgtcttccggcggcgattccc
gatgacatcgctgctattttcgatccgttcggcaacgcggtgcatacggcgctggcgttt
gatctggtgggtgaagacgtgttggtaagcggcgcggggccgattggcgtcatggcggcg
gcggtttgccgccatgtcggcgcccgtcatgtggtgattaccgacgtcaatgactaccgg
ctggcgctggcgcggcggatgggcgttaaccgggcggtgaatgtagcgcgggaatcgctg
accgacgtgatgcgggaactgggtatgaccgaaggatttgacgtcgggctggagatgtcc
ggcgcgccggcggccttgcgcacgttgctgtcggtgatgaaccacggcggtcgcatcgcc
atgctgggtattccgccggaagccgtatcggtagactggagtgacatcattttcaagggg
ctggtgattaaaggtatctacggccgtgaaatgtttgaaacctggtacaaaatggcggcg
ttgatccagtccggactggatctgtcgccgatcatcacccatcgctacgccattgacgat
ttccaaaacgggtttgatgtgatgcgctccggccaatccggcaaggtggtgctgagctgg
taa

DBGET integrated database retrieval system