KEGG   Dickeya fangzhongdai: CVE23_15330Help
Entry
CVE23_15330       CDS       T05277                                 

Definition
(GenBank) beta-galactosidase
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
dfn  Dickeya fangzhongdai
Pathway
dfn00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:dfn00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    CVE23_15330
Enzymes [BR:dfn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     CVE23_15330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M Glyco_hydro_42C DUF4434 DUF4838 Cellulase Glyco_hydro_2_C Glyco_hydro_14
Motif
Other DBs
NCBI-ProteinID: ATZ95228
UniProt: A0A2K8QQB5
LinkDB All DBs
Position
complement(3462373..3464430)
Genome map
AA seq 685 aa AA seqDB search
MKRFPPLNPKVDGLLHGADYNPEQWENYPGIIDDDIAMMKQVKCNVMSVGIFSWAKLEPQ
EGVYRFDWLDEVLDKLYRQGISVFLATPSGARPAWMSQRYPEVLRVGRDRVPALHGGRHN
HCLSSPVYRDKVQKINTLLAERYGRHPAVIGWHISNEYSGECHCERCQRAFRTWLQARYQ
TLDNLNHAWWSDFWSHTYSDWSQIESPAPQGEVSIHGLNLDWRRFNTAQATDFCAQEIAP
LKRVNPAIPATTNFMEYFYDYDYWQLSRVLDFISWDSYPMWHRDKDDATLACYIALFHDL
MRSLKQGKPFVLMESTPSVTNWQPLSKLKKPGMHILSSLQAVAHGADAVQYFQWRKSRGS
VEKFHGAVVDHVGHVDTRVGREVAQLGQILSQLDAVAGSRVEAQVAILFDWESRWAMDDA
QGPRNAGLEYEKTVAEHYRPFWEQGIAVDVINADGDFSGYRLLIAPMLYMVRPGFAERVE
QFVRQGGHVVVTYWSGIVNESDLCYQGGFPGPLRPVLGIWSEEIDCLADGEYNRVLGLAD
NDIGLKGPYQARHLCELIHLEGATALASYCDDFYAGRPAVTVNHVGAGKAWYVTSRNDLA
FQRDFFAAIMRELALPRALDIPLPPAVTAHRRTNGDEEFIFIENYSALPQPIQLPAGYSD
MLTGLPLVDVVLSAWDCRVIRRRLV
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgatttccgcctttgaatccgaaggtcgatgggttattacatggcgctgattat
aatccggagcaatgggagaattaccccggcattattgacgacgatatcgccatgatgaaa
caggtaaaatgcaatgtaatgtcggtcggtattttcagctgggccaaactggagccgcag
gagggcgtgtaccggttcgactggctggatgaggttctcgataaattataccggcagggt
atttcggtgtttctggcgacacccagcggcgcacgcccggcctggatgtcgcaacgttac
ccggaagtgctgcgcgtagggcgcgatcgggtgccggcgctgcacggtggtcgtcacaat
cactgcctgtcatcgccggtctatcgggataaggttcaaaaaatcaatacattgctggcg
gagcgctacgggcgtcacccggcggtgatcggctggcatatttccaatgaatacagcggc
gagtgccattgcgagcgctgtcagcgggcgtttcgcacctggctgcaggcgcgttaccag
acgctggataacctcaatcacgcctggtggagcgatttctggagccatacctacagcgac
tggtcacagattgaatcgccggcgccgcagggcgaagtgtccattcacgggttgaacctt
gactggcgacgctttaataccgcgcaggcgaccgatttctgcgcgcaggaaatcgccccg
ttgaagcgggtgaacccggctatcccggcgaccaccaacttcatggagtacttttacgat
tacgactactggcagctgtcgcgcgtgctggacttcatctcctgggacagctacccgatg
tggcaccgggacaaggacgacgccacgctggcctgttatatcgccctgtttcacgatctg
atgcgttcgctgaagcagggcaagccgtttgtgttgatggaatcgacccccagcgtcacc
aactggcagccgctcagcaagctcaagaagccgggtatgcatattctctcctcgctgcag
gcggtggcccacggcgcggatgcggtgcagtacttccagtggcgcaagagccgcggctcg
gtggaaaaattccacggcgcggtggtggatcatgtcggccatgttgatacccgcgtcggc
cgcgaagtggcgcagctcggccagattttgtcgcaactggatgcggtggcgggcagccgg
gtagaggcgcaggtagcgatcctgtttgactgggaaagccgctgggcgatggatgatgcg
caggggccgcgcaatgccgggttggagtacgaaaaaacggtggcggaacactaccgcccg
ttctgggagcaggggatcgccgtcgatgtcatcaacgccgacggcgatttcagcggctac
cggctgttgattgcgccgatgctgtacatggtgcggccggggtttgccgagcgcgtcgag
cagtttgtgcgccagggcgggcacgtggtggtgacctactggagcggcatcgttaacgaa
agcgacctgtgttatcagggcggattccccggcccgttgcgcccggtgctgggcatctgg
tcagaagagatcgactgtctggccgacggcgaatataaccgggtgttggggctggcggac
aatgatatcgggctgaaagggccgtatcaggcgcgccacctgtgcgagttgatccacctt
gaaggcgcgacggcgctcgccagctactgcgacgatttctatgccggccggccggcggtg
acggtaaatcacgtcggcgcagggaaagcctggtatgtgacctcgcgtaacgatctggcg
ttccagcgcgatttctttgccgccatcatgcgtgagctggctctgccgcgggcgctggat
atcccgctgccgccggcggtgacggcccatcgccgtaccaacggcgacgaagagtttatc
ttcatcgaaaactacagtgcgttgccgcagcctatccagttgcccgccgggtatagcgat
atgctgaccgggttgccgctggtggatgttgtcctttccgcctgggattgccgggtgatt
cgtcgccgtctggtctga

DBGET integrated database retrieval system