KEGG   Dehalogenimonas formicexedens: Dform_00184Help
Entry
Dform_00184       CDS       T04654                                 

Gene name
aroB
Definition
(GenBank) 3-dehydroquinate synthase
  KO
K01735  3-dehydroquinate synthase [EC:4.2.3.4]
Organism
dfo  Dehalogenimonas formicexedens
Pathway
dfo00400  Phenylalanine, tyrosine and tryptophan biosynthesis
dfo01100  Metabolic pathways
dfo01110  Biosynthesis of secondary metabolites
dfo01130  Biosynthesis of antibiotics
dfo01230  Biosynthesis of amino acids
Module
dfo_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:dfo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Dform_00184 (aroB)
Enzymes [BR:dfo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.4  3-dehydroquinate synthase
     Dform_00184 (aroB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHQ_synthase Fe-ADH_2 Fe-ADH DJ-1_PfpI
Motif
Other DBs
NCBI-ProteinID: APV43547
UniProt: A0A1P8F4Y4
LinkDB All DBs
Position
complement(173511..174590)
Genome map
AA seq 359 aa AA seqDB search
MSVQLCVDLSDRGYPVHIGQGLLGQLPDLLKEAGFLGRLMIVTNPDIAGLHGNRLLGTLR
SAGFSPELVLVPGGEAYKSLVTAGHLYEDLSKKQAERGTPIIALGGGVIGDLSGFVAATY
QRGVPFIQLPTTLLAQVDSSIGGKVAVNVGSLKNMAGVFYQPRMVVADISTLSTLPIDEL
RNGMAEVIKSAIIGDAELFAFLESDMPRILNREPEALSFIVERSAVVKARIVEQDERDSG
IRNYLNLGHTFGHALETITRFEMKHGAAVAAGMAAAARLSRLLNLLSGADNDRIINVIAA
AGLPGAFDAGARSGAFIEAISHDKKKTAGKLKFVLPAGIGNVIIKDGIEPNEAIEALRG
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgtcagttcagctttgcgtcgatcttagtgaccgcggctaccctgtccacatcggccag
ggcttgctcggccaactgccggatctattaaaggaagccgggttcctcgggcggttgatg
attgtcaccaacccggacattgccgggctgcatggcaaccgtctcctcggcacgttgcgt
tcagccgggttcagcccggagctggtcctggtccccggaggagaggcttacaaatccctg
gtgaccgccggacacctctacgaagacctttcgaaaaagcaggctgaacgcggtacgccg
atcatcgccctcggcggcggcgtcatcggcgatctgtccgggtttgtcgccgccacctac
cagcggggagtgcctttcattcaacttccgaccacgctcctggcgcaggttgattccagt
atcggcggcaaggtggcggtcaacgtcggcagcctcaagaatatggccggggttttctac
cagcccaggatggtcgtggccgatatctcaaccctgtcgactttaccgatcgacgaatta
cgcaacgggatggccgaggtgattaaatcggcgatcatcggcgatgccgaactctttgca
tttctcgaaagtgacatgccgcgaatattgaatcgggaaccggaggcgctcagcttcatc
gtcgagcgttcggctgtggtcaaggcgcgcatcgtggaacaggacgagcgggattcggga
atccgcaactatttgaacctggggcacaccttcggccacgccttggaaacgatcaccaga
ttcgaaatgaagcacggggcggcggtggccgcgggcatggcggccgcagcgcgtttatcc
cggcttttgaacctgctgtcgggagcagacaacgatcggattatcaacgttatcgccgcc
gccggattgccgggcgctttcgacgccggtgcccgatcaggcgctttcatcgaagcgata
agccatgacaagaaaaaaaccgccggcaagctgaaattcgttctgcctgccggcataggt
aacgtcatcataaaagacggtatcgagccgaacgaagcgatcgaggcgttgagagggtga

DBGET integrated database retrieval system