KEGG   Dehalogenimonas formicexedens: Dform_00363Help
Entry
Dform_00363       CDS       T04654                                 

Definition
(GenBank) glucoamylase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
dfo  Dehalogenimonas formicexedens
Pathway
dfo00500  Starch and sucrose metabolism
dfo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dfo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Dform_00363
Enzymes [BR:dfo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     Dform_00363
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucodextran_N Glyco_hydro_15
Motif
Other DBs
NCBI-ProteinID: APV43723
UniProt: A0A1P8F5H6
LinkDB All DBs
Position
complement(325439..327901)
Genome map
AA seq 820 aa AA seqDB search
MGRNAKNHHRAIQANFGDTAVTRFRGERTAFGKPGLEPHWTAGDKDGIGTTSSLSSRIWF
TIWSGILTEVYYPTIDRPQMKDFQFLITDGKSFFHEEKRDTYSEIKRLSPHVLGYKVTNS
DHEGRYSIVKEIIADPRLPCVIQHVELVGYDRFLANLKIYVLCTPHMERGGWGNNARVVE
VAGRQILACEKEGTWMTVAASIPFRRLSCGYVGTSDGWTDLADNFRMDWEFDKALNGHVA
LTGELALDEAREFSIGLSFGDTLHSSVTTLFQTLGVPFKKHLKQFNLQWNSFCRSIKPLE
KASQDQGDLYHASYSLLTAHEDKIYPGAFIASLSIPWGEVRGDSERGGYHLVWTRDMVNT
AMGLLAAGNADAPRRALIYLAASQQPDGGFPQNFWINGDPYWQGIQLDEVAFPILLAWKL
QKSGLIRDFDVYEMVWRAAGYLVKHGPATQQERWEEASGYSPSTLASNIAALVCAASFME
DKGDTASADFLREYADFLECHIEAWTVTNQGSILPNIKRHYIRINPVSVTDSTPDENPDI
KTLGIHNRPAGERWQFPAKDVVDAGFLELVRYGIRKADDQLIQDSIAVIDSSLKIETPFG
PCWHRYNHDGYGQGNNGEPFQGSGKGRAWPLLTAERAHYELAAGHDVKPFIRAMEGFASY
TGLLPEQVWDEADLPEKHLFLGRPTGSAMPLMWAHAEYIKLLRSVTDGAVFDIIPDVAAR
YLSEKRRHGFLEIWKPNRQPGSVIAGWTLRVQSPEPFKLIWTDNEWQDTKNSPSLQINLG
ISYLDIPVALNQEAPIGFTFLWTNSDRWEGRNYEVTVKKA
NT seq 2463 nt NT seq  +upstreamnt  +downstreamnt
atggggcgaaacgccaaaaatcaccatcgggctatccaggccaattttggagacactgca
gtgacaagattccgcggcgaaaggacagccttcggcaaaccggggctggagccccattgg
actgccggggataaggacggtatcggcaccacgtcttcactttccagccgcatctggttc
accatctggagcggaatacttaccgaggtgtactaccccaccatcgaccgcccgcaaatg
aaggattttcaattcctgataacggacggcaaatcattctttcacgaggaaaaacgggat
acctattcggagatcaaacgcctgtcgccgcacgtcctgggatataaggtaaccaattcc
gaccatgagggccggtactcaatcgtgaaagaaattatcgccgatccaaggctgccgtgc
gtaatccagcatgtcgagctggtggggtacgaccggttccttgcgaacttgaaaatctac
gttttatgcacgccgcacatggaaaggggaggatggggcaataacgcccgggtggttgag
gttgccggacggcagatccttgcctgcgaaaaggaaggcacctggatgacagttgccgcc
agcatcccctttcgccgcctatcctgcggttatgtcggcaccagcgatggctggaccgac
ctggcagataatttccggatggattgggagttcgataaggcgttgaacgggcacgtcgcc
ctgaccggagagttggcgctggacgaagccagggaatttagtatcggactttctttcggc
gataccttgcacagttcggtgacgacgcttttccaaactctgggggttcccttcaagaag
cacctcaagcaattcaacttacaatggaacagtttctgccgttccatcaagccgctggag
aaagcatcccaggatcagggcgatttataccacgccagctacagcctactcaccgcccat
gaggacaagatttatccgggagcatttatcgcctctctctctatcccctggggcgaagtc
aggggagattccgaaagaggcgggtatcacctggtatggacccgggatatggtcaacacc
gccatggggttgctggcagcgggtaacgcggatgctcctcgccgggcgcttatttacctc
gcagcaagccagcagccggacgggggctttcctcagaacttctggattaacggcgatcct
tactggcagggcattcaactcgatgaagtggcattccccattttactcgcctggaagctg
cagaagagtggtttgatccgggatttcgacgtgtacgaaatggtctggcgcgccgccggc
tatctcgtaaagcacggccccgccacccagcaggaacgttgggaagaagccagcggttat
tcgccttccacgctggcttccaatatcgccgcgctggtctgcgccgcgtccttcatggaa
gacaaaggcgacaccgcttccgcggatttcctccgggaatatgcggacttcctggagtgt
cacatcgaggcctggacggttaccaaccaggggagtatcctcccgaacatcaaacggcac
tatattagaatcaacccggtaagcgtcaccgacagcacaccggacgaaaatccggacatc
aagaccctggggatccataaccgccccgcgggcgagcgatggcaatttccggccaaagac
gtcgtcgacgccggtttcctggaacttgtccgctatggcataagaaaagccgacgaccaa
ctgattcaagattcgatagccgttatcgattctagcctgaagattgagacgcctttcggc
ccctgctggcatcgatacaaccatgatggttacggtcagggaaataacggcgaacccttc
cagggctccgggaaagggcgggcgtggccgctcttgaccgcggaacgggctcactatgaa
ctggccgccggccacgatgtcaaacctttcatccgggcgatggagggttttgcctcctac
accgggctgctgccggaacaggtatgggatgaggcagacttaccggaaaagcacttgttc
ctgggacggccgaccggttcggcgatgccgctgatgtgggcgcacgcggaatacatcaag
ctcctccgctccgtcaccgatggggctgttttcgatatcattccggatgtagccgcgcgg
tatttgtcggaaaaacgccggcacggtttcctggaaatctggaaacccaaccggcagccc
gggtcggttattgcggggtggacactcagagtgcaatcgccggaaccctttaaactgatc
tggacggacaatgaatggcaggatacaaaaaattcaccttccctgcagatcaacctgggt
atcagttaccttgacatcccggttgccctgaatcaggaggcgcccatcgggtttaccttt
ttgtggacgaacagcgatcgttgggaagggcgaaattacgaggttacggtcaaaaaagct
tag

DBGET integrated database retrieval system