KEGG   Dehalogenimonas formicexedens: Dform_01312Help
Entry
Dform_01312       CDS       T04654                                 

Definition
(GenBank) superoxide dismutase, Fe-Mn family
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
dfo  Dehalogenimonas formicexedens
Brite
Enzymes [BR:dfo01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Dform_01312
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: APV44640
UniProt: A0A1P8F872
LinkDB All DBs
Position
1247365..1247940
Genome map
AA seq 191 aa AA seqDB search
MYTATDFNHLKGMPGFSETLLNNHFTLYQGYIKNTNKLFETLDALSKAGKSDTPEFAELQ
RRFGFEWNGMRLHELYFGNLGGDGLLAPAVKLEKKLAEAWGSREAWEKDFRAVGSLRGVG
WAVLYQDPVSGALFNCWINLHESGHLAGCNPLLVMDVWEHAFMIDYGLKRADYIDAFFKN
IDWAACEKRLK
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgtacaccgccacggatttcaatcacctgaaaggaatgccgggattttccgagactctg
cttaacaaccatttcactctgtaccagggttacatcaaaaacaccaacaagctcttcgaa
acgctcgatgccctgtccaaagcgggcaagtccgatacccccgaattcgccgaactgcag
cgccgcttcggtttcgagtggaacggcatgagactgcacgagctgtatttcggcaacctc
ggcggcgacggtttgctggcgcccgcggtcaagctggagaaaaaactggctgaggcctgg
ggcagccgcgaggcgtgggagaaggatttccgggctgtcggttcgctgcggggcgtcggc
tgggcggtgctctaccaggatccggttagcggcgccttattcaactgctggatcaatctc
cacgaatccgggcacctggccggatgcaatcccctcctggtaatggacgtctgggaacat
gccttcatgatcgattacgggctgaagcgcgccgactatatcgatgccttcttcaagaat
atcgattgggcggcctgcgagaaacgcctcaagtaa

DBGET integrated database retrieval system