KEGG   Dolichospermum flos-aquae: HGD76_21620
Entry
HGD76_21620       CDS       T06652                                 

Definition
(GenBank) 2-oxo acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
dfs  Dolichospermum flos-aquae
Pathway
dfs00010  Glycolysis / Gluconeogenesis
dfs00020  Citrate cycle (TCA cycle)
dfs00620  Pyruvate metabolism
dfs01100  Metabolic pathways
dfs01110  Biosynthesis of secondary metabolites
dfs01120  Microbial metabolism in diverse environments
dfs01200  Carbon metabolism
Module
dfs_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:dfs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HGD76_21620
   00020 Citrate cycle (TCA cycle)
    HGD76_21620
   00620 Pyruvate metabolism
    HGD76_21620
Enzymes [BR:dfs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     HGD76_21620
SSDB
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Other DBs
NCBI-ProteinID: QJB46391
UniProt: A0A6H2C4Z0
LinkDB
Position
complement(4520113..4521426)
AA seq 437 aa
MSINEVFMPALSSTMTEGKIVSWVKSPGDKVEKGETVVVVESDKADMDVETFYEGYLAHI
IVPAGETAPVGAAIAYIAETEAEIATAQSLANADGAAAPSTPAPIPVPAAAIAAPATPSQ
NGSNHEPGRVVVSPRARKLAKELKVDLNTLTGSGPYGRIVAEDIEVAVGKVQPVTTPVVT
PAPAPVAAPAPVAAPVPVAAPAPVATPVVTSAVPGQVVPFTTLQNAVVRGMVASLSVPVF
RVSYTISTDGLDKLYKQIKSKGVTMTALLAKAVAITLQKHPILNASYSDQGIVNHPNINV
SVAVAMDDGGLITPVLQNADAVDIYSLSRNWKSLVERARAKQLQPVEYNSGTFTLSNLGM
FGVDTFDAILPPGQGSILAIGASRPQVVATADGLFGVRQQMQVTVTCDHRIIYGADAAGF
LQDLAKLIETNPQSLTM
NT seq 1314 nt   +upstreamnt  +downstreamnt
atgagcattaacgaagtatttatgccggcgctgagttccaccatgaccgaaggcaaaatt
gtctcctgggtcaagtcgcctggagataaagtggagaaaggcgaaacagtggtggttgtc
gaatcagataaagctgatatggacgtggaaaccttctatgaaggatatcttgcccatatc
attgttcccgccggtgaaactgccccagtcggcgcagcgatcgcatacattgccgaaaca
gaagcagaaatcgccacagcccagtccttagccaacgcagacggtgctgctgctccctcc
acacctgcccctatacccgtacccgctgccgcaattgccgcccctgccaccccatctcaa
aatggttctaaccatgaacccggcagagtcgtagtttcaccccgcgctcgcaaactagcc
aaagaactcaaagttgatttaaatactctcacaggtagtggtccctacggtcgtattgtg
gcggaagatatagaagtggcagtcggtaaagtccaacccgttactacccccgttgtcact
cccgcacctgcacctgtagccgcacctgcacctgtagccgcacctgtacccgtagctgca
cctgcacctgtcgccacaccagtagttactagtgccgttcctggtcaagtagtgccattc
acaaccttacaaaatgcagtagttcggggcatggtagccagtttatctgtacctgtgttc
cgtgtcagttacacaattagcaccgatggactcgataaactttacaaacaaattaagtct
aaaggtgtgacaatgaccgcgctattagccaaagctgtagccataacattacaaaaacac
cccatccttaatgccagctactcagatcaaggaattgtcaatcaccctaatattaacgtt
tctgtcgccgtagccatggatgatggtggtttaatcacacccgttttacaaaatgcagat
gcagttgatatctactctttatctcgcaattggaaatctttagtagaacgcgctagagct
aaacaactacaaccagtagaatataacagcggtactttcaccctctccaacttgggaatg
tttggtgtagatacctttgatgccattttaccgcctggacaaggttctatcttagccatt
ggcgcatcacgtccccaagtagtagccacagccgacggcctatttggtgtccgtcaacaa
atgcaagtaactgttacctgtgatcatcgtatcatttatggtgctgatgccgccggattc
ttgcaagacttagcaaaattgattgaaaccaatcctcagtctttgacaatgtaa

DBGET integrated database retrieval system