KEGG   Deinococcus geothermalis: Dgeo_0661Help
Entry
Dgeo_0661         CDS       T00353                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
dge  Deinococcus geothermalis
Pathway
dge00620  Pyruvate metabolism
dge00680  Methane metabolism
dge01100  Metabolic pathways
dge01120  Microbial metabolism in diverse environments
dge01200  Carbon metabolism
Module
dge_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:dge00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Dgeo_0661
  09102 Energy metabolism
   00680 Methane metabolism
    Dgeo_0661
Enzymes [BR:dge01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Dgeo_0661
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase
Motif
Other DBs
NCBI-ProteinID: ABF44963
UniProt: Q1J0M1
LinkDB All DBs
Position
complement(717742..720237)
Genome map
AA seq 831 aa AA seqDB search
MGLSHDVNVLGRTLGQVLKEQEGEGFFELVERTRALVRDVRAGGDDTELRGLIERLDQRT
AENLVRAFSWYFQLVNLAEEYERVRVLSGIQGVRPQSIAQALTELKAQGVTAEEAEALLQ
RLDLGLTFTAHPTEMRRRTVRNHLVEVARDIPHLDGEGLERVAAHIEAMWGTPELRRLKP
TVLDEVKGGLNYVSSIAQALPELQRDLVRAFHQVYGRATQAPLPLSFSSWMGGDRDGNPF
VTPQATRDTLALHRERARELLLGVLRQAYTDLSQEDLEEPEQAPYRAELRELHQAVREGE
PVDLVPRLEALRARLYADGQHRSADLLLTPLLTVARVFGQHLVSLDLREHSAQTGAAVAR
LLAEAGVETDYLNLPEHAKQEVLTRELRSRRPLWPAGEALPAELENAIGPIREVQAATRV
SGPRAFGRYIISMSESVSDVLEPLLLAREVGFRILPVPLFETLADLDRAPQVVWELLSVP
EYRAVLGDDVQEIMLGYSDSNKDAGFLAANWALHEAQRKISEVCRRAGVRWRFFHGRGTS
IGRGGGPAARAILGQPAGTIDAGLRITEQGEALADKYSHPVLARRNLEQALYGLLLAAAR
PAENPPAEWTQALTRAAEASAAAYRALVHDPDFLPFFEAVTPIHEIARLNIASRPVRRPG
APSLGNLRAIPWVMSWTQNRANLPGWYGLAEGLREIGPDLARQMYQEWPFFRTVLDNAQM
SLAKSDFLIFAEYLRLSGEQRLAEQLRAAYDETVRLVQEAVGAELLTNEPRLRASIKLRN
PYIDPIHRIQVELLRRARSAAGSADDSGTDEYERPLLLSLQGIAAGVRNTG
NT seq 2496 nt NT seq  +upstreamnt  +downstreamnt
gtggggctgagccatgacgtgaatgtgctggggcgcacgctggggcaggtgctcaaggaa
caggagggtgaaggctttttcgagctggttgagcgtacgcgggcgctcgtgcgcgacgtg
cgtgctgggggcgacgacaccgaactgcgcggcctgatcgagcgtctggatcaacgcacc
gccgagaatctggtgcgggcctttagctggtacttccagctggtgaatctggccgaagag
tacgagcgggtccgggtgctgtcaggcatccagggcgtgcgcccgcagagcatcgcacag
gccctgacggagctgaaagcgcagggcgtgaccgccgaggaggccgaggcgctgctccag
cggctggatctgggcctcaccttcaccgcacacccaaccgagatgcgccgccgcacggtc
cgcaaccatctggtggaggttgcgcgagacatcccccatctggacggtgaggggctggaa
cgggtggccgcccatatcgaggcgatgtggggcacgcccgagctgcgccgcctcaagccc
accgtgctcgacgaggtcaagggcggactgaactacgtgagctctatcgcgcaggcgctg
cctgagctgcagcgcgacctggtgcgggccttccatcaggtgtacgggcgcgcgacgcag
gcaccgcttcccctcagtttcagttcgtggatgggtggggaccgcgacggcaaccccttc
gtcacgccgcaagccacccgcgacacgctggccctgcaccgcgagcgggcgcgcgagctg
cttctcggagtgctgcggcaggcgtacacggacctcagtcaggaagacctggaggagccg
gagcaggcgccctaccgtgccgaactgcgcgagctgcatcaggccgttcgagagggtgaa
ccggtcgaccttgtgccccggctggaagcgctgcgggcgaggctctacgcagacggccag
caccgcagcgctgacctgctgctcacgccactgctgacggtcgcgcgggtgttcgggcag
cacctcgtcagcctggatctccgcgaacacagcgcgcaaacgggcgcggcggtcgcgcgg
ctgctggcagaggccggcgtggagacggactacctgaacctccccgaacatgccaaacag
gaggtgctcacccgtgaactccgctcgcgccgcccgctgtggcccgctggagaggcgctg
cccgcggagctggaaaacgccatcggtcccatccgcgaggtccaggcggccacccgcgtg
agtgggccgcgcgcctttgggcgctacatcatcagcatgagcgagagcgtttcggatgtg
ctggagccgctgctgctggcgcgcgaggtgggctttcgcatcctgccggtgccgctgttc
gagacgctcgccgacctcgaccgcgcgccacaggtcgtatgggagctgctcagcgtaccc
gagtaccgcgccgtgttgggagatgacgtgcaggagatcatgctggggtacagcgactcc
aacaaggacgcgggctttctggccgccaactgggcactgcacgaagcccaacgcaagatc
agcgaggtgtgccgccgagccggcgttcggtggcggtttttccatggccgcggtacctcg
atcgggcggggaggcggcccggcggcccgggccatcctaggtcagcctgccggaacgatt
gacgcgggcctgcgcatcaccgaacagggcgaggcgctggccgacaagtacagccacccg
gtcctggcgcggcgcaacctcgaacaggccctctacggcctgctgctcgccgccgcccgc
cccgccgaaaacccgcccgccgaatggacgcaggcgctgacgcgggcagccgaggcgagc
gccgccgcctaccgcgcgttggtccatgaccccgacttcctgccgttctttgaggcggtc
acgcccatccacgagatcgcccggctcaacatcgcctcacgacccgtgcgccgtccgggg
gcgcccagtctgggcaatctgcgcgcgattccctgggtgatgagctggacacaaaatcgc
gccaaccttcccggctggtatggccttgcggagggcctgcgcgaaatcggccccgatctc
gcgcggcaaatgtaccaggagtggccctttttccgcacggtgctggacaacgcgcagatg
agcctcgccaagagtgactttctgatcttcgcggagtacctgcgcctctcgggcgagcaa
cggctggccgagcagctccgggccgcctacgacgagacggtgcggctggtgcaggaagca
gtcggcgcggagctgctgacgaacgagccgagactgcgcgcgagcatcaagctccgcaac
ccctacatcgacccgatccaccgcattcaggtcgaactgctgcgccgcgcccgtagcgcc
gcgggcagcgccgacgattcaggcacagacgagtatgagcggcccctgctgctcagcctc
cagggcatcgcggcgggggtgcggaatacaggctga

DBGET integrated database retrieval system