KEGG   Deinococcus geothermalis: Dgeo_0725Help
Entry
Dgeo_0725         CDS       T00353                                 

Definition
(GenBank) Glucan 1,4-alpha-glucosidase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
dge  Deinococcus geothermalis
Pathway
dge00500  Starch and sucrose metabolism
dge01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dge00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Dgeo_0725
Enzymes [BR:dge01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     Dgeo_0725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucodextran_N Glyco_hydro_15 DUF2919
Motif
Other DBs
NCBI-ProteinID: ABF45027
UniProt: Q1J0F7
LinkDB All DBs
Position
784017..786413
Genome map
AA seq 798 aa AA seqDB search
MSDASAQNPPEQLLATPGSPELISPAQGLAPGAPGLPPTWASSDKDFVTTALGGASRLWA
TGGHGMLNEVYWPSTGQPQIRDLTFYLVGAAGWVDLRRVRRYQLSTPKPYLPLPTLLHQG
DDYQLMLEVLPDPHRDVLLIRYALSGPYRLAIVLAPHLTSTGHDNAAWVEGQHLLAVSGN
RALALLSSSRMEHLSAGYVGVSDGWQDLHQHGRLTWSYERAENGNVALSAELQDASGLLA
LGFAENVTGAQGLARASLAEGDEPARRAFLYAWEAWGSALKLGGPSPELEAEALLSATVL
KVHEDRTYPGALVASLSIPWGDSTDTLGGYHLVWPRDATLAAFALLACNQREDARRVLAW
FIANQQPDGHWLQNYYPDGQDFWHGVQLDETAFPVLLAAKLREEGEPELEGTRDMVRRAL
AFVARTGPTSDQDRWEENQGVNPFTLAVAIAALVAGSGWLEEDERHYALSLADDWNERLE
SLCYVTGTPLCRELGVEGYYVRLAPPDRDGTLTGQVTLQNRQGKTVEAAALVSLDFSYLP
RLGLRSALDPRIRDTVKVVDQLLAQKTPTGIFYHRYNGDGYGEHEDGAPYDGSGMGRLWP
LLSGERGHLALQAGEDATVYLNSLLRCSSPGGLLPEQVWDGPPLPERGLFPGRPSGSAMP
LLWAHAEFLKLLHTAQTGRPAELLREVEERYRQPLPAQARHWRPAAPVPELEPGLLLLIE
DDKPFLLHYGFDGWQNPQDRPALRLPFGLWGVTFSPGELREHHTLDFTRKLAVGWEGQDH
HIRLHEGAPKASLTAQNG
NT seq 2397 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacgcttccgctcagaaccccccagaacagctcctggcaaccccaggttccccg
gaactgatttctcccgcccagggcctggcccccggtgcccccggcctgcccccaacctgg
gcgagcagcgacaaggacttcgtgacgacggccctggggggcgcgtcccgactgtgggcg
accggtggccacggaatgctgaacgaggtgtattggccctccaccgggcagccacagatt
cgtgacctgaccttttatctggtgggggcggccggctgggtggacctgaggcgggtgagg
cgctaccagctgtccacgcccaagccgtatctgccccttcctaccctgctgcaccagggg
gacgactaccagctcatgctggaggtgctgcccgatccacaccgcgacgtgctgctgatc
cgctacgccctgagcggtccctatcgcctggcgatcgtgctggcgccccacctcacctcc
accggacatgacaacgccgcctgggtcgagggtcagcacctgctggcggtgtccgggaac
cgcgcgctcgcgctgctgtcgagcagccggatggaacacctgagcgccgggtacgtggga
gtttcggacggctggcaggacttgcaccagcatgggcgcctcacctggagctacgagcgg
gcggaaaacggcaacgtggccctcagtgccgagctgcaggatgcctccgggcttctggca
ctgggttttgcggaaaacgtgaccggcgcgcagggcctggcccgcgccagcctcgcggaa
ggggacgagcctgcccgccgcgcctttttgtacgcctgggaagcctggggcagcgccctc
aagctcggcggtcccagccctgagttggaggccgaggctcttctcagcgcgacggtcctc
aaggtgcacgaggaccgcacctatcccggcgcgctggtcgccagcctcagcattccctgg
ggagacagcaccgacacgctgggcggctaccaccttgtctggccgcgcgacgcgacgctg
gcggcctttgctctgctggcctgcaatcagcgtgaggacgcgcgccgggtgctggcgtgg
ttcattgccaaccagcagcccgacggccactggctccagaactactatccagacggtcag
gacttctggcacggcgtgcagctcgacgagacggcctttccggtgctgctggccgccaag
ctgcgcgaggagggcgagccggagctggagggcactcgcgacatggtgcgccgcgcgctt
gcctttgtggcccgcaccggtcccaccagtgaccaggaccgctgggaggagaaccagggg
gtgaacccctttacgttggcggtcgcgattgccgcgctggtggcggggtcgggctggttg
gaggaggacgagcgccactatgccctcagcctggcggatgactggaacgagcggctggaa
agcctctgctacgtgaccggcacgccgctgtgccgtgagctgggggtggagggctactac
gtgcggctggcgccccctgaccgcgacggcaccctcaccggccaggtgacgctccaaaac
cgccaaggcaaaacggtagaggcagcggcgttggtcagtctggatttttcttatctgccg
cgactgggcctgcgttcggcgctcgatccacgcattcgcgacaccgtgaaggtggtggat
cagctgctggcccaaaagacgccgaccggcatcttctaccaccgctacaacggcgatggc
tacggcgaacacgaggacggggcgccctacgacggctccggaatggggcggttgtggccg
ctgctgagcggcgagcgtggccacctggcgcttcaggcgggcgaggacgccaccgtctac
ctcaacagcctgctgcgctgctctagccccggcggcctgctgcccgagcaggtctgggac
gggccacccctgcccgaacgcggcctctttcccgggcggcccagcggcagcgcgatgccg
ctgctgtgggcgcacgctgaatttctgaagctgctgcacaccgcgcagacgggccgcccc
gccgaactgttgcgcgaggtggaggaacgctaccgccagcctcttcctgcccaggctcgc
cactggcgccccgccgcaccggtgcccgaactcgaacccggcctgctgctgctgatcgag
gatgacaagcctttcctgctgcactacggctttgatggctggcaaaacccccaggaccgc
ccagccctgcgcctcccctttggcctgtggggtgtcaccttcagtccgggcgaactgcgc
gagcaccacaccctcgacttcacgcgcaagctggcggtgggttgggaggggcaggaccat
cacatccggctccatgagggcgcgcccaaggcgtccctgaccgcgcagaacgggtga

DBGET integrated database retrieval system