KEGG   Deinococcus geothermalis: Dgeo_0830Help
Entry
Dgeo_0830         CDS       T00353                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
dge  Deinococcus geothermalis
Brite
Enzymes [BR:dge01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Dgeo_0830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ABF45132
UniProt: Q1J052
LinkDB All DBs
Position
890936..891574
Genome map
AA seq 212 aa AA seqDB search
MAYQLPQLPYAYDALEPHIDARTMEIHHTKHHQTYIDNANKALEGTEFADLPVEELIQKL
DQVPADKKTVLRNNAGGHANHSLFWQVMTPQGQGQPTGELAQAINETFGSFEAFKQQFED
AAKGRFGSGWAWLVVKPGGQLAVVSTANQDNPLMGEAIAGASGTPILGVDVWEHAYYLNY
QNRRPDYLKAFWNVVNWDEVARRYQQAKSQAQ
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atggcttaccaacttccccaactgccctatgcctacgatgccttggagccccacatcgac
gcgcgcacgatggagattcaccacaccaagcaccaccagacctacatcgacaacgcgaac
aaggcgctggaaggcacggagtttgctgatctgccggttgaagagctgattcagaagctc
gatcaggtgccggccgacaagaagactgtgctgcgcaacaacgcgggtggccacgccaac
cacagtctcttttggcaggtgatgacgccccaggggcagggccagcccacgggcgaactc
gcgcaggcgatcaacgagaccttcggttcctttgaggctttcaagcagcagtttgaggac
gccgccaagggccgcttcggctctggctgggcctggctggtggtgaagcccggcggtcag
ctcgccgtcgtcagcaccgccaaccaggacaacccgctgatgggcgaagccattgcgggt
gcgagcggtacgccgatcctgggcgtggacgtgtgggaacacgcctactacctcaactac
cagaaccgccgcccggactacctcaaggccttctggaacgtggtgaactgggacgaggtg
gcccgccgctaccagcaggcgaagtcgcaagcgcagtaa

DBGET integrated database retrieval system