KEGG   Deinococcus geothermalis: Dgeo_1198Help
Entry
Dgeo_1198         CDS       T00353                                 

Definition
(GenBank) maltodextrin phosphorylase
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
dge  Deinococcus geothermalis
Pathway
dge00500  Starch and sucrose metabolism
dge01100  Metabolic pathways
dge01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dge00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Dgeo_1198
Enzymes [BR:dge01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     Dgeo_1198
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3417 Phosphorylase DUF3416 FMP23
Motif
Other DBs
NCBI-ProteinID: ABF45495
UniProt: Q1IZ39
LinkDB All DBs
Position
complement(1273197..1275725)
Genome map
AA seq 842 aa AA seqDB search
MNVIGQVTVLPQLPPELGRLSELAYNLYWSWTPHAQALYRDLDPAIWERFQHNPVRVLLE
VSQDRLTQAAADPEYVGRYTRVLADFDAYMHKKDTWASRHAADLAPVAYFSMEYGFAESL
PIYSGGLGVLAGDHCKSASDLGLPFTAVGMLFHQGYFRQLLNREGWQEEAYDELDLTTLP
LRPAQTPAGEEVRVQAQIADRDVQVRVWELAVGRIKVLLLDTNVPENSEDDRKLTARLYG
GNQDLRFQQYLLLGVAGIRALRALNIPAGVYHMNEGHAALLGLERIRELVEGGLDFRTAL
ETVASNTLFTTHTPVPAGNDAFAYDLVDRYLGQWPARLHTSREELYGLARQDQFWDGHWV
PTFSMTVLALNLSRAANGVSELHGEVSRDMWKFLYPGAEAAEVPIGHITNGAHNLTFTSQ
AMRDLLSTVLPADWTERLQEEEMWAAVEGLSDAQLADVQLDMKREMIAFVRRRLREQLTR
NGASAAEVAATENVLSEKALTIGFARRFATYKRATLLFRDKARLSRIVNDPDRPVQFVFA
GKAHPADNPGKAFIQEIYRVSQEPEFRGKIVMLENYDLNVARHLVQGVDIWLNNPRRPLE
ASGTSGMKASFNGAPNFSILDGWWREGYDGTNGWPIGEDREYADLNVQDDADAYSLYQTL
EHQIVPLYYAPASPEAEGRSGWAQMVRRAIQTVSPRFSMQRQVIDYTQQYYLPLSKRGAI
LAANGSQRAREIASWKTWVRQQWPHTSLNATAHLPATAKPGQKIEVQASVNPAGIRPEEL
RVEAVLKRGNHVTRVPLAPQGDGRYSAQVPLEDSGLYSVGVRMLPEIDGLSNELEAGLIK
WA
NT seq 2529 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtcatcggtcaggtcaccgtccttccccagttgcctccggagctggggcggctt
tccgaactcgcctacaacctgtactggtcgtggaccccgcacgctcaggcactgtaccgc
gacctcgatcccgcaatttgggagcgcttccagcacaaccccgtgcgggtgctgctggag
gtatcgcaagaccgtctgactcaggccgcagccgacccagagtatgtgggccggtacacg
cgggttctggccgacttcgacgcttacatgcacaaaaaggacacctgggcgagccggcat
gcggcggacctggccccggtggcctacttcagcatggaatatgggtttgccgagtcgctg
ccgatctacagtggtggcctgggtgtgctggcgggcgaccactgcaagagtgcttccgac
ctgggcctgccctttaccgccgtcgggatgctgtttcaccagggctactttcgtcagctg
ctcaaccgcgagggctggcaggaggaagcctatgacgagcttgacctgaccaccctgccc
ctccgccccgcccagacgcccgccggcgaggaggtccgggtacaagctcagattgcggac
cgtgacgtgcaggtgcgggtctgggaactcgcggtgggccgaatcaaggtgctgctgctc
gacaccaatgtgcccgaaaacagcgaggacgaccgcaagctcaccgcgcggctctacggc
ggcaaccaggacctgcggttccagcagtacctgctgttgggtgtggcggggattcgcgcg
ctgcgtgcgctgaatattccggcgggcgtctatcacatgaacgaggggcacgcggcgctg
ttgggcctggagcggatccgggagctggtggaaggcgggctggatttccgtaccgccctg
gagacggtcgcgagcaacaccctctttacgacccacacgccggtccccgccggaaacgat
gcctttgcctatgacctggtcgaccggtacctgggtcagtggcccgcgcgcctccatacc
tcccgcgaggaactctacggcctcgctcggcaggaccagttctgggacggccactgggtt
ccgaccttcagcatgacggtgcttgccctgaacctcagccgcgccgcaaacggcgtatcc
gagttgcacggcgaggtcagccgcgacatgtggaaattcttgtatccgggtgcagaagcg
gcggaggtgcccatcgggcatatcaccaacggcgcacataacctcaccttcacctcgcag
gcgatgcgcgacctgctgagcaccgtcctgcctgccgactggaccgaacgcctccaggaa
gaggagatgtgggcggcggtggagggcctctccgacgcgcagctcgcggacgtgcagctg
gacatgaagcgcgagatgatcgctttcgtgcgccgccgcctgcgcgagcagctcacgcgc
aacggggccagcgctgctgaagtggctgccaccgagaacgtgctctccgagaaggcgctg
accatcggcttcgcgcggcgctttgccacctacaagcgggccaccctgctgtttcgtgac
aaggcccgtctcagccgtatcgtgaacgacccggaccgcccagtgcagtttgtctttgct
gggaaggcgcaccccgccgacaacccgggcaaggcctttattcaggagatctaccgagtc
agtcaggagcccgagttccgcggcaagatcgtgatgctggaaaactatgatctgaacgtg
gctcgccaccttgtgcagggcgtagacatctggctgaataacccccgccgcccgctggag
gcgtctggcaccagcgggatgaaggccagctttaacggcgcgcccaacttcagcattctg
gacggttggtggcgtgaggggtacgacggcaccaacggctggcccatcggcgaggaccgc
gagtatgccgacctgaatgtgcaagacgatgccgatgcctacagcctctaccagacgctc
gagcatcagatcgtgccgctgtactacgcgcctgcctcgccggaggcggaaggacggagc
ggctgggcgcagatggtccgccgcgccatccagactgtcagcccgcgcttctcgatgcag
cggcaggtaattgactacacgcagcagtactacctgccgcttagcaaaaggggcgcgatc
ctggcggcaaacggcagccagcgcgcccgcgagatcgccagctggaagacctgggtgcgc
cagcagtggccgcacaccagcctgaacgcgacggctcacctgcccgctactgccaaaccc
ggtcaaaagatcgaggtgcaggccagcgtgaacccggcggggattcgccctgaggaactg
cgcgtcgaagcggtgctcaagcgcggcaaccacgtgacccgcgtgcccctcgctccgcag
ggggacggccggtacagtgcccaggtgcccttggaagacagcggcctgtactcggtgggg
gtgcgcatgctgcccgagatcgacggcctcagcaatgaactggaggccggcctcatcaag
tgggcctga

DBGET integrated database retrieval system