KEGG   Deinococcus geothermalis: Dgeo_2161Help
Entry
Dgeo_2161         CDS       T00353                                 

Definition
(GenBank) malate dehydrogenase
  KO
K00024  malate dehydrogenase [EC:1.1.1.37]
Organism
dge  Deinococcus geothermalis
Pathway
dge00020  Citrate cycle (TCA cycle)
dge00270  Cysteine and methionine metabolism
dge00620  Pyruvate metabolism
dge00630  Glyoxylate and dicarboxylate metabolism
dge00680  Methane metabolism
dge01100  Metabolic pathways
dge01110  Biosynthesis of secondary metabolites
dge01120  Microbial metabolism in diverse environments
dge01130  Biosynthesis of antibiotics
dge01200  Carbon metabolism
Module
dge_M00009  Citrate cycle (TCA cycle, Krebs cycle)
dge_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
dge_M00012  Glyoxylate cycle
dge_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:dge00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Dgeo_2161
   00620 Pyruvate metabolism
    Dgeo_2161
   00630 Glyoxylate and dicarboxylate metabolism
    Dgeo_2161
  09102 Energy metabolism
   00680 Methane metabolism
    Dgeo_2161
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Dgeo_2161
Enzymes [BR:dge01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     Dgeo_2161
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ldh_1_C Ldh_1_N
Motif
Other DBs
NCBI-ProteinID: ABF46455
UniProt: Q1IWC9
LinkDB All DBs
Position
complement(2277542..2278546)
Genome map
AA seq 334 aa AA seqDB search
MTMNQGTKQPVRVAVTGAAGQIGYSLLFRIAAGDMLGKDQPVILQLLEITPALKALAGVV
MELRDCAFPLLADIVTSDDPLVAFKDADYALLVGAMPRKAGMERGDLLGANGGIFKPQGE
ALNKVASRDVKVLVVGNPANTNALIAQQNAPDLDPKQFTAMVRLDHNRAISQLAEKTGQP
VSAIKNITIWGNHSSTQYPDLSQATVNGQPALDLVDREWYEKEYIPTVAKRGAAIIEARG
ASSAASAASAAIDHMRDWALGTPEGEWVSMAVPSDGSYGIPEGLIYGFPVRCRNGQYEIV
QGLEISDFSRQKMDATAKELEEEREEVRRLGLVK
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgacgatgaaccaaggcaccaagcaacccgttcgcgtggccgtgaccggcgccgccggg
cagatcggctacagcctgctttttcgcattgcggcgggcgacatgctgggcaaggatcag
ccggtgatcctacagttgctggagatcacgcctgccctcaaggcgttggcgggcgtcgtg
atggagctgcgcgactgcgctttcccgttgctggcggatatcgtgaccagtgacgatccg
ctggtggcctttaaggacgcggactacgccctcctcgtcggtgctatgccgcgcaaggcc
gggatggagcgcggcgacctgctgggcgcgaacggcggcatcttcaagccgcagggcgag
gcgctgaacaaggtggcgagccgagacgtgaaggtgctcgtggtggggaaccccgccaac
accaacgccctgatcgcccagcagaacgcgcctgacctcgatcccaagcagttcaccgcg
atggtgcgtctggaccacaaccgcgcgatctcgcagcttgccgagaagaccggccagccc
gtgagtgccatcaagaacatcaccatctgggggaaccactcttccacccagtaccccgac
ctctcgcaggcgaccgtgaacggccagcccgccctcgacctggtggaccgcgagtggtac
gagaaagaatacattccgacggtcgccaagcgtggcgcggcgatcatcgaggcgcgtggg
gccagctctgccgcttctgccgcctccgctgcgattgaccacatgcgcgactgggcgctg
ggcaccccggaaggcgagtgggtcagcatggcggtgcccagcgacggctcctacggcatt
cctgagggtttgatctacggcttcccggtgcgttgccgcaacggccagtacgagatcgtg
cagggcctcgagatcagtgacttcagccgccagaagatggacgccaccgccaaggaactg
gaagaagagcgcgaagaagtgcgtcggcttggtctggtgaagtaa

DBGET integrated database retrieval system