KEGG   Desulfovibrio gigas: DGI_1747Help
Entry
DGI_1747          CDS       T02851                                 

Definition
(GenBank) putative Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
dgg  Desulfovibrio gigas
Pathway
dgg00970  Aminoacyl-tRNA biosynthesis
dgg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dgg00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    DGI_1747
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:dgg03029]
    DGI_1747
Enzymes [BR:dgg01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     DGI_1747
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     DGI_1747
Mitochondrial biogenesis [BR:dgg03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    DGI_1747
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey TetR_C_15
Motif
Other DBs
NCBI-ProteinID: AGW13559
UniProt: T2GBN5
LinkDB All DBs
Position
complement(1871919..1873367)
Genome map
AA seq 482 aa AA seqDB search
MAAYQAVIGLEVHAQLSTKSKLFCSCPTAFGAEPNRHVCEVCCGMPGVLPVLNKKAVELA
VKAGLALGCEIQLRSIFARKNYFYPDLPKAYQISQYEEPVCQGGSVEIETSQGVRVVPLT
RIHMEEDAGKSIHAAHEHKSYVDLNRAGVPLIEIVSEPAMHSAEEAAAYLKALHAILVYL
GVCDGNMEEGSFRCDANISLRPVGETALGTRTELKNLNSFRNVQRAIEFEIARQQDVLDD
GDRVIQETRLFDADKNATFSMRGKEEAHDYRYFPDPDLAAVQLDQAWVDAWKTELPELPR
ARRQRFIAELGLPPADADMLTADKRLADYLEAALASYGPGRPEAAKKLANWIMGELVREL
NAAGVSACASPFTPAHLAELVECVEAGTISGKIGKQIFPELFAGGASPKAYIEAKGLVQI
SDSSALETEILAVIAANPKEHAEFKAGKTKLMGFFVGQVMRRTKGQANPALVNELLAKHL
NG
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atggcagcatatcaagccgtcatcgggctggaagtgcacgcccagctctcgacgaagtcc
aagttgttttgcagttgccccaccgccttcggcgccgagcccaaccgccatgtgtgcgag
gtgtgctgcggcatgcccggcgtgctgccggtgctgaacaaaaaggccgtggaactggcc
gtcaaggccgggctggcccttggctgcgagatccaactgcgctccatctttgcccgcaag
aactacttttacccggacctgcccaaggcctaccagatctcccaatacgaggagcccgta
tgccagggcggcagcgtggagatcgaaacgtcccagggcgtgcgcgtggtcccgctgacg
cgcatccatatggaagaggacgccggcaagtccatccatgccgcccatgagcacaaaagc
tacgtggacctgaaccgcgccggggtgccgctcatcgagatcgtctccgagccggccatg
cactccgccgaggaagccgccgcctacctgaaggccctgcacgccattctggtgtacctg
ggcgtgtgcgacggcaacatggaagaaggctccttccgctgcgatgcgaacatctccctg
cggcccgtgggcgaaaccgccctgggcacccgcacggagctgaagaacctgaattccttt
cgcaacgtgcagcgggccatcgagttcgagatcgcccggcagcaggatgtgctggatgac
ggcgaccgcgtgatccaggaaacccgcctgttcgatgcggacaagaacgccaccttctcc
atgcgcggcaaggaagaggcccacgactaccgctacttccccgatccggacctggctgcg
gtgcagttggatcaggcctgggtggacgcctggaagacggaactgcccgagctgccccgc
gcccggcggcaacgcttcatcgccgagctgggcctgcccccggccgatgccgacatgctc
accgcggacaagcgtctggcggactatctggaagccgccctggccagctacggcccaggc
aggcccgaggccgccaaaaagctggccaactggatcatgggcgaactggtgcgcgaactc
aacgccgccggcgtgagcgcctgcgcctcgcccttcaccccggcgcatctggccgagctg
gtggaatgcgtggaagccggcaccatcagcggcaagatcggcaagcagatcttccccgaa
ctgttcgccggcggcgcctcgcccaaggcatacatcgaggccaagggactggtgcagatt
tccgactcctcggccctggagacggagatcctggccgtcatcgccgccaatcccaaggaa
catgcggagttcaaggccggcaagaccaagctcatgggctttttcgtgggccaggtcatg
cgccgcaccaagggtcaggccaacccggccctggtcaacgaactcctggccaaacacctg
aacgggtaa

DBGET integrated database retrieval system