KEGG   Desulfovibrio gigas: DGI_1765Help
Entry
DGI_1765          CDS       T02851                                 

Definition
(GenBank) putative translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
dgg  Desulfovibrio gigas
Brite
KEGG Orthology (KO) [BR:dgg00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:dgg03012]
    DGI_1765
   03029 Mitochondrial biogenesis [BR:dgg03029]
    DGI_1765
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dgg04147]
    DGI_1765
Translation factors [BR:dgg03012]
 Eukaryotic Type
  Elongation factors
   DGI_1765
 Prokaryotic Type
   DGI_1765
Mitochondrial biogenesis [BR:dgg03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    DGI_1765
Exosome [BR:dgg04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   DGI_1765
  Exosomal proteins of breast cancer cells
   DGI_1765
  Exosomal proteins of colorectal cancer cells
   DGI_1765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase Lsm_C
Motif
Other DBs
NCBI-ProteinID: AGW13570
UniProt: T2GAH0
LinkDB All DBs
Position
1883660..1884853
Genome map
AA seq 397 aa AA seqDB search
MGKAKFERSKPHVNIGTIGHIDHGKTTLTAAITKVLSMKGQSKFIAFDQIDKAPEEKERG
ITIATAHVEYETANRHYAHVDCPGHADYIKNMITGAAQMDGAILVVAATDGPMPQTREHI
LLARQVGVPTLVVFMNKVDLVDDEELLELVELEVRELLSKYGFPGDDIPVIRGSALGALQ
VDTADDPATACIHELMAACDSFIPEPVRDIDKPFLMPIEDVFSISGRGTVVTGRVERGIV
KVGEEVEIIGIKNTVKTTCTGVEMFRKLLDQGQAGDNIGALLRGVKREDVERGQVLAKPG
SITPHKKFKAEVYVLSKEEGGRHTPFFTGYRPQFYIRTTDVTGVIKLAEGVEMVMPGDNA
TFEVELIHPIAMEKGMRFAIREGGRTVGAGVVSEIME
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaggcaaaattcgaacggtccaagccgcacgttaacatcggcaccatcgggcac
atcgaccatggcaagaccacgctgacggctgccatcaccaaggtgttgtcgatgaagggc
cagtccaagttcatcgccttcgaccagatcgacaaggcgcctgaagaaaaggaacgcggc
atcaccatcgccacggcccacgtggagtacgaaaccgccaatcgccattacgcgcacgtg
gactgccccggccacgccgactacatcaagaacatgatcaccggcgcagcccagatggac
ggcgccatcctcgtggtggccgccactgacggccccatgccccagacccgtgagcacatc
ctgctcgcccgtcaggtcggcgtgcccacgctggtggtgttcatgaacaaagtggacctg
gtggatgacgaagaactgctggagctggtggaactggaagtgcgcgagctgctctccaag
tacggcttccccggcgacgacatcccggtgatccgcggctctgccctgggcgcgctgcag
gtcgatacggctgacgatccggccaccgcctgcatccacgaactgatggccgcgtgcgac
agcttcatccccgagcccgtgcgcgacatcgacaagcccttcctgatgcccatcgaagac
gtgttctccatctccggccgcggcactgtggtgaccggtcgcgtggagcgcgggattgtg
aaagtgggcgaggaagtggaaatcatcggcatcaagaacacggtgaagaccacttgcacg
ggcgtggaaatgttccgcaagctgctggatcagggccaggccggcgacaacattggtgcg
ctgcttcgcggcgtcaagcgtgaggatgtggaacgcggccaggtgcttgccaagcccggt
tccatcaccccgcacaagaagttcaaggcggaagtgtacgtgctctccaaggaagaaggc
ggccggcacacgccgttcttcaccggctatcgcccccagttctacatccggaccacggac
gtgactggcgtgatcaagctggccgagggcgtggaaatggtcatgcccggcgataacgcg
accttcgaggtcgagctcatccaccccatcgccatggaaaaaggcatgcgcttcgccatc
cgcgaaggcggccgcacggttggcgctggcgttgtgtctgagatcatggagtaa

DBGET integrated database retrieval system