KEGG   Desulfovibrio gigas: DGI_1881Help
Entry
DGI_1881          CDS       T02851                                 

Definition
(GenBank) putative phosphate ABC transporter, ATP-binding protein
  KO
K02036  phosphate transport system ATP-binding protein [EC:7.3.2.1]
Organism
dgg  Desulfovibrio gigas
Pathway
dgg02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:dgg00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    DGI_1881
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:dgg02000]
    DGI_1881
Enzymes [BR:dgg01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.1  ABC-type phosphate transporter
     DGI_1881
Transporters [BR:dgg02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphate transporter
    DGI_1881
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N RsgA_GTPase AAA_15 AAA_29 AAA_33 Rad17 AAA_22 AAA_16 Adeno_IVa2 AAA_23 PRK AAA_18 IstB_IS21 AAA_24 NACHT IIGP
Motif
Other DBs
NCBI-ProteinID: AGW13670
UniProt: T2GBR6
LinkDB All DBs
Position
complement(2005256..2006128)
Genome map
AA seq 290 aa AA seqDB search
MDERTPDASSATAKAGASGKGPKRVPRDNRQTVGTQHVPEPRMRCVDVNVYYGDKHAINN
VSMDIGNNEVIAMIGPSGCGKSTFLRCLNRMNDTIDSCRVTGLIELDGRNIYDPKVDVVP
LRAQVGMVFQKPNPFPKSIYENIAYGPRIHGLVNTKSEMDEIVETSLKRAGLWNEAKDRL
DQPGTGLSGGQQQRLCIARTIAVSPEVILMDEPCSALDPIATSIIEDLIDELREHFAIAI
VTHSMQQASRVSQRTAYFHLGDLIEIGPTEQIFTNPLHELTHDYITGRFG
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atggacgagcgcacccccgacgcatcctccgccacggccaaggccggcgcctccggaaag
gggcccaaacgcgtcccccgcgacaatcgccagaccgtcgggacccagcacgttcccgaa
ccgcgcatgcgttgcgtggatgtcaacgtctattacggcgacaagcatgccatcaacaac
gtgtccatggacatcggcaacaacgaggtcatcgccatgatcggtccctcgggctgcggg
aagtccaccttcctgcgatgcctgaaccgcatgaacgacaccatcgacagctgccgcgtc
accggacttattgaactggacggccggaacatctatgatcccaaggtggacgtagtcccc
ctgcgggcccaggtgggcatggtgttccagaagcccaacccgttcccaaaatccatttat
gaaaacatcgcctatgggccgcgcatccatggcctggtgaacaccaagagcgagatggac
gagattgtggaaacgtccctcaagcgcgccgggttgtggaacgaggccaaggaccggctg
gaccagcccggcaccgggctttccggcgggcagcagcagcgcctgtgcattgcccgcacc
atcgccgtgagtccggaagtcatcctcatggatgagccgtgctccgccctggaccccatt
gcgacgtcgattatcgaagacttgatcgacgaactgcgcgaacatttcgccatcgcaatc
gtcacgcattccatgcagcaggcctcccgcgtttcccagcgtacagcctattttcacctg
ggcgacctcatcgaaatcggccccacggagcagattttcacgaacccgctccatgaattg
acgcacgattacatcactggccgcttcggctag

DBGET integrated database retrieval system