KEGG   Desulfovibrio gigas: DGI_2153Help
Entry
DGI_2153          CDS       T02851                                 

Gene name
glgP
Definition
(GenBank) putative glycogen phosphorylase
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
dgg  Desulfovibrio gigas
Pathway
dgg00500  Starch and sucrose metabolism
dgg01100  Metabolic pathways
dgg01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dgg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    DGI_2153 (glgP)
Enzymes [BR:dgg01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     DGI_2153 (glgP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3417 Phosphorylase Capsule_synth
Motif
Other DBs
NCBI-ProteinID: AGW13914
UniProt: T2GCK6
LinkDB All DBs
Position
complement(2246665..2249232)
Genome map
AA seq 855 aa AA seqDB search
MQPLRVFSVAPKLPRPLEPLRELAYNFWFSWNPRIEELFAQLDPRLWRETAKNPVLFLNR
APQSLLQSVAADENYLERLKEARASLEQYTTRTTGGVPFPPAESGQPAVAYFSLEYGFSL
SMPIYSGGLGILAGDHLKSASDLNTPLVGIGLFYLKGYFRQYLTPDAWQQERYPVNDFEQ
MPVVLLKDAAGQPLLVDVDLAGQTLYAQIWRAQVGRIALYLMDTNIPQNPEHLRAVTANL
YGGGLEMRLWQEILLGIGGIKALRVLGLTPKVIHMNEGHSAFAGLERIRHYMKREGLSLE
AALELSASTSIFTTHTPVPAGNDRFPSDLIQRYFEGYARDMGVAFKVFMALGREDPRDDS
EHLCMTVLALKLSRFNNGVSRLHGRVSRTMWQRVWPQYPLEDVPIGAITNGVHAPSWVAP
DMALLYDRYLGGNWREDPDCTRAWSLADTISDSELWRTHERLRARLVDFVRWKLRKQMES
KGVGRRLLELASEVLDPDALTIGFARRFATYKRAGLLLRDKQRLFSLVSNKARPVQFVFA
GKAHPADQGGKKLIQELVQFCQQEDCRMRMVFLEDYDMDTAAHMVQGVDVWLNTPRRPLE
ACGTSGMKALVNGVLNLSTLDGWWDEAYKPDNSVGWAIGQGEEYEDDEYQDFVESQTLYN
ILENDVIPLFYDRDHSRLPKHWVRRMKASLKELVPLYSAHRMVEDYTRQAYIPACENFDK
LRQNNYKAAAELATWRMDIMTRWSGLQIQNIQTDAPAALTVSETVTVTCEVLLNDIKADH
LLVEIYSGPLDTDGRFTSRLTFPMQPAGQPVNGWQRFEGQAQPEDAGRFGFTVRILPRHP
LLLDPHALGLIKWGA
NT seq 2568 nt NT seq  +upstreamnt  +downstreamnt
atgcagccactgcgcgttttcagcgttgcccccaagctgcctcgccccttggagcccttg
cgggagctggcttacaacttctggttctcctggaatccgagaatcgaggaattgtttgcc
cagctggaccccagactgtggcgggaaactgccaagaatcccgtactgttcctgaaccgc
gccccgcaaagcctgctgcaatctgtggcggcggacgaaaactacctggaacggctcaag
gaagccagggccagccttgagcaatacaccacccgcaccaccggcggcgtcccctttccc
cctgcagaatccggacagcctgcagtggcctacttcagcctggaatacgggttttccctg
tccatgcccatttattccggcggcctgggcattctggccggcgaccacctcaagtcagca
agcgacctgaacacgccgctggttggcatcgggctgttttatctcaaaggatatttccgc
caatacctgacgccggacgcctggcagcaggagcggtatcctgttaatgatttcgaacaa
atgcctgttgtcctcttgaaggacgccgccggacagcccctgctggtggatgtggatctg
gctgggcagacgctgtatgcgcaaatctggcgcgcccaggtgggccgcattgccttgtat
ctgatggatacgaacatcccgcagaatcccgaacacctgcgggccgtcaccgccaacctg
tacggcggcgggctggagatgcggctgtggcaggaaatcctgctgggcatcggcggcatc
aaggcgttgcgggtgctcgggctcacgcccaaggtgatccacatgaacgaaggtcacagc
gccttcgccgggttggagcgcattcgccattacatgaagcgcgaagggctttcgctggaa
gccgccctggagctttccgcctccacctccatcttcaccactcacacccctgtgccagcc
ggcaacgaccgcttcccctcggacctcatccagcggtattttgaaggctatgcccgggac
atgggcgtggcgttcaaggtgttcatggccctgggccgcgaagacccccgcgacgacagc
gaacacctgtgcatgaccgtgctggccctcaagctctcccgcttcaacaacggcgtctcc
cgcctgcatggccgggtgtcgcgcaccatgtggcagcgggtctggccccagtatcccctg
gaagacgtgcccattggcgccatcaccaacggcgtgcacgcccccagctgggtggcgccg
gacatggccctgctctatgatcgctacctgggcggcaactggcgcgaagatccggactgc
acccgtgcctggagcctggcggataccatctccgactccgaactctggcgcacccacgag
cgcctgcgcgcccggctggtggactttgtccgctggaaactcagaaagcagatggaatcc
aagggcgtgggccggcggctgctggaactggccagcgaggtgctggatccggacgccctg
accatcggttttgcccgccgcttcgccacgtacaagcgcgccggcctgctgctgcgggac
aagcaacggctgttctccctggtttccaacaaggcccggcccgtgcagttcgtctttgcc
ggcaaggcccacccggcagaccagggcggcaagaagctcatccaggagctggtgcagttc
tgccagcaggaagactgccgcatgcgcatggtcttcctggaagattacgacatggacacc
gccgcccacatggtccagggcgtggacgtgtggctgaacaccccccgccggcccctggaa
gcctgcggcaccagcggcatgaaagccctggtgaacggcgtgctcaacctctccaccctg
gatggctggtgggacgaagcctacaagcccgacaactccgtgggctgggccatcggccag
ggcgaggaatatgaggacgacgagtatcaggacttcgtggagagccagaccctctacaac
atcctggaaaacgacgtcatccccctgttctacgaccgcgaccactcccgcctgcccaag
cactgggtgcgccgcatgaaggcatcgctcaaggagctggtgcccctgtacagcgcccac
cgcatggtggaagactacacccggcaggcctacatcccggcctgcgagaacttcgacaag
ctgcgccagaacaactacaaggctgccgccgaactggccacctggcgcatggacatcatg
acccgctggagcggcctgcagatccagaacatccagacggatgctccggccgcccttacc
gtgagcgagaccgtcaccgtcacctgcgaagtgctgctcaacgacatcaaggccgatcat
ctgttggtggagatctactccggccccctggatacggacggccgcttcacctcccggctc
accttccccatgcagcccgcggggcagccggtgaacggctggcagcggttcgaggggcag
gcccagcctgaggacgccgggcgcttcggcttcacggtgcgcattctgccgcgccacccc
ctgctgctggatccccatgccctggggctcatcaaatggggcgcgtaa

DBGET integrated database retrieval system