KEGG   Desulfotomaculum gibsoniae: Desgi_0349Help
Entry
Desgi_0349        CDS       T02657                                 

Definition
(GenBank) translation elongation factor TU
  KO
K02358  elongation factor Tu
Organism
dgi  Desulfotomaculum gibsoniae
Brite
Translation factors [BR:dgi03012]
 Eukaryotic Type
  Elongation factors
   Desgi_0349
 Prokaryotic Type
   Desgi_0349
Mitochondrial biogenesis [BR:dgi03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Desgi_0349
Exosome [BR:dgi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Desgi_0349
  Exosomal proteins of breast cancer cells
   Desgi_0349
  Exosomal proteins of colorectal cancer cells
   Desgi_0349
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW
Motif
Other DBs
NCBI-ProteinID: AGK99926
UniProt: G6I6G2
LinkDB All DBs
Position
326282..327484
Genome map
AA seq 400 aa AA seqDB search
MAKAKFERTKPHVNIGTIGHVDHGKTTLTAAITTVLSTVGGASVKKYDEIDNAPEERERG
ITINTAHVEYETATRHYAHVDCPGHADYVKNMITGAAQMDGSILVVSAADGPMPQTREHI
LLSRQVGVPYIVVYLNKADQVDDAELLELVDMEVRELLSQYEFPGDDIPVITGSALKALE
CGCGKRECEWCKSVWELMDAVDAYVPTPERDIDKPFLMPVEDVFTITGRGTVATGRIERG
AVKVGEEVEIVGLMDKPRKTVVTGVEMFRKILDRGEAGDNVGCLLRGVDRKEIERGQVLA
KPGSIKPHTKFNAEVYVLTKEEGGRHTPFFNGYRPQFYFRTTDVTGVAQLPEGVEMVMPG
DNIKMNIELITPIALEEGLRFAIREGGRTVGAGVVTGINE
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaggcgaaatttgagcggactaaaccgcacgtaaacatcggtaccatcggccac
gtggaccacggtaaaaccaccctgaccgcggctatcaccaccgtgctgtccacagtgggc
ggagcttcagtgaaaaagtacgatgaaattgacaatgccccggaagaaagagagcgcggt
ataaccatcaacaccgctcacgtggaatacgagaccgcgaccagacactacgcgcacgta
gactgccccggccacgccgactacgtcaagaacatgatcaccggcgcagcccagatggac
ggctccatactggtggtatcagctgccgacggtcccatgccccaaacccgtgagcatatt
ctcctttcccgccaggtgggcgtgccctacatcgtggtttacctgaacaaagccgaccag
gtagacgatgccgaattgctggaactggtggacatggaagtgcgtgagcttttaagccag
tacgaattccccggggacgacatcccagtaatcaccggttcggcattaaaggcgctggaa
tgcggctgcggcaaacgggaatgcgagtggtgcaagagcgtatgggaactgatggacgct
gtagatgcctacgttcccacaccggagcgcgacattgacaagccgttcttgatgcctgtg
gaagacgtattcaccatcacgggtcgtggtaccgtggccaccggtcgtatagagcggggc
gctgttaaagtaggtgaagaagtagaaatcgtaggtttgatggataaaccgcgcaagact
gtggtcaccggcgtggaaatgttccgcaagatactggaccgcggtgaagcgggtgacaac
gtaggctgtctgctgcgcggcgtagaccgtaaagaaatcgagcgcggccaggtgctggcc
aaacccggcagcatcaagccccataccaaatttaacgcagaagtatacgtgctgaccaaa
gaagaaggtggccggcataccccgttcttcaacggctaccgtccgcaattttacttccgt
accaccgacgtgaccggcgtggcccagctgccggagggtgtggaaatggttatgccgggc
gacaacattaaaatgaatatcgagcttattactcccattgctttagaagaaggtttgcgt
ttcgccattcgtgaaggtggtcgtaccgtaggtgccggtgtggttaccggtatcaacgag
taa

DBGET integrated database retrieval system