KEGG   Desulfallas gibsoniae: Desgi_2284Help
Entry
Desgi_2284        CDS       T02657                                 

Definition
(GenBank) chemotaxis protein histidine kinase-like protein
  KO
K03407  two-component system, chemotaxis family, sensor kinase CheA [EC:2.7.13.3]
Organism
dgi  Desulfallas gibsoniae
Pathway
dgi02020  Two-component system
dgi02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:dgi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Desgi_2284
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Desgi_2284
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dgi01001]
    Desgi_2284
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:dgi02022]
    Desgi_2284
   02035 Bacterial motility proteins [BR:dgi02035]
    Desgi_2284
Enzymes [BR:dgi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     Desgi_2284
Protein kinases [BR:dgi01001]
 Histidine kinases
  CheA family [OT]
   Desgi_2284
Two-component system [BR:dgi02022]
 CheA family
  CheA-CheYBV (chemotaxis)
   Desgi_2284
Bacterial motility proteins [BR:dgi02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Desgi_2284
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheW P2 H-kinase_dim Hpt HATPase_c HATPase_c_3 HATPase_c_2
Motif
Other DBs
NCBI-ProteinID: AGL01706
UniProt: R4KPX7
LinkDB All DBs
Position
complement(2306028..2308151)
Genome map
AA seq 707 aa AA seqDB search
MFSSEEIAIFQEELEEKMQIISDNILLLEQQQATPEIIQEIFRAAHTIKGSSAIMGYDKM
TKLTHELESLFDELRHNRLEITGDLVDVLFEAVDKLTELKDETTGNATKNIDISPVLQKI
KQVKQTPGADINNQYGHDRLYKPVEQGTSKVSDSNQLLPEIEVDDVTEDVISEAEIRGYH
AYGLQVVFAEDCQMKEVRAFLLFETLEQVGEIIKTNPQIEDIQSGYFNSSIALIIISQSD
IDQVKNLALSVAEIKAVHIQKIKVNNTPEQEMQTAADRKNMAKATPTAAKLPNSDNNGPK
KAIKTVRVDVEKLNTLMNLVGELVIERTRLERFVNVFESKFGSEDIAEDILEISSHLGKV
TTDLQDEIMKARMLPVAQVFNRFPRMVRDIAHKLGKEIDFIIEGKETELDRNVIEVIGDP
LIHLLRNSIDHGIEDARERQRLGKPAQGHLKLKASYSEGHIVINVEDDGRGIDMQKLKSK
ALQRGLITQEHYDRMSDREAQELIFAPGFSTVEEDHVSDISGRGVGMDIVRTQIENINGL
VDYYAVPGQGTRFSIKLPLTLAITRALMVECSSKTYAFPLTYVVETLYVNRSEIKTIRHS
EVIIIRGQVCPIKRLGDIFNHKTSKNDDSKVYLVVVGSGDRKLGVIVDELIGEQEIVIKS
LGSYLGQVEGLAGAAILGDGKVSLIVDVRSLVRSAGSEEALLYAAAN
NT seq 2124 nt NT seq  +upstreamnt  +downstreamnt
gtgtttagtagtgaagaaattgccatctttcaagaagaactggaagaaaaaatgcaaata
atcagcgataatatacttctattggagcagcagcaagccacacccgaaattattcaggaa
atatttcgggccgctcataccataaagggatcttccgccataatgggctacgataaaatg
acaaaattaacccatgagttggaaagcttattcgatgaactacgtcataaccggttggaa
ataaccggtgacctggtggacgtgctttttgaagccgttgataaattaacggaattaaaa
gacgaaacaactggcaatgccactaaaaatatagatatcagtccggtgttacaaaaaatc
aaacaagtaaaacaaacaccgggagccgacattaataaccaatatggacacgaccggctg
tataagcccgttgaacagggaacgtcaaaagtaagtgattccaatcaactgctgccggag
atcgaagttgatgacgtaaccgaggatgtcatcagcgaagcagaaatccgtgggtaccat
gcctatggcctgcaggttgtttttgcggaagactgccagatgaaggaagtacgtgctttt
ctgctctttgaaactttagagcaggtgggcgagatcattaaaaccaacccccaaatagag
gatattcaaagcggttattttaacagtagtatagcactgattattattagccagtcagac
atcgaccaggttaaaaacctggccctctcggtagcggaaatcaaggctgtacatatacaa
aaaattaaagttaataataccccggagcaggaaatgcaaactgcggcggaccggaaaaac
atggccaaagcaactcccactgccgcaaaactgcccaacagtgataacaacggtccaaag
aaagccataaaaaccgtccgggtagacgtggaaaaattaaacaccctgatgaatctggtc
ggggaactggtaattgaacgcaccaggttggagcgttttgtaaatgtctttgaaagcaaa
ttcggctccgaagacattgccgaagatatattagaaatatccagtcacctgggtaaggtt
actactgatttacaggacgaaatcatgaaagcgcgcatgctgcccgttgcccaggtattc
aatcgtttcccacgcatggtaagggatatagcccataaacttggcaaagaaatcgacttt
attatcgaaggtaaagaaaccgaacttgaccgtaatgtgattgaagtaatcggagacccg
ttaatccacctgttaagaaactccattgaccacggcattgaagatgcccgggaaaggcag
cgcttgggcaaaccggctcaaggccacctcaagttaaaagcatcttattcagaagggcac
attgtcattaacgtggaagatgatgggcggggcattgacatgcaaaaattaaaaagcaaa
gccctgcagcgaggtttaataacgcaggagcattatgaccggatgagtgaccgggaagcc
caggagcttatttttgcaccgggtttctcaacagtggaagaagaccatgttagtgacatt
tccggtcggggtgtgggtatggatatagtacgcacccaaatagaaaatatcaatggccta
gtggattattacgccgtgcccggtcagggtacccggttttccataaagctgccgctaacc
ctggccataacccgcgcgctaatggtcgaatgcagctccaagacttacgcatttcctcta
acctacgtggtggaaaccctttacgtcaatcgttcggagataaagaccatcagacattct
gaagtgataatcattcgcgggcaggtatgccctataaaacgactgggagatatattcaat
cataaaacatcaaaaaatgatgacagcaaggtttatttagtcgttgtcggttctggtgac
cgtaaactgggtgttatagtagatgaattaatcggtgagcaagaaatagtcattaaatcc
ctgggctcttacctcggccaggtggaaggactggccggagcagccatactgggagacggt
aaagtatccttgattgtggatgtgcgaagcttggtaagaagcgcgggctccgaggaggcc
ttattatatgccgcagccaattaa

DBGET integrated database retrieval system