KEGG   Desulfallas gibsoniae: Desgi_3207Help
Entry
Desgi_3207        CDS       T02657                                 

Definition
(GenBank) hypothetical protein
Organism
dgi  Desulfallas gibsoniae
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AGL02561
UniProt: R4KSJ9
LinkDB All DBs
Position
complement(3246893..3247684)
Genome map
AA seq 263 aa AA seqDB search
MNPWLNLLYKEYRMSRSSFPILMGVLFIGVLCMQFLSQRYPSETGLFSIIYLLSLVCAFA
LFCPAVFMFTSISHELKRAPHLWFHCPQPAWMLLSAKLVTGLVYMLVLLLVESILVYWLF
NSYSPEQTGITKTNMASFITGIGAYVALAVVNFGLYLASWATLLAVVNARGRNLWPAVLA
IFFAATWGINRFEKTWFFEKLTHWGTIQANTLLFNGEYLLSSGNINISFAAGQIYTGENL
FYLVLAISIFALSAWLINRKVEV
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgaatccttggttgaatctgctttacaaggagtacaggatgagcaggagttctttcccg
atcctgatgggagtgctgttcatcggtgtgctctgcatgcaattcctttcccagcgctat
ccatcggaaacgggcttgtttagtattatttatctgctttccctggtttgtgcctttgcc
ttgttttgcccggctgtttttatgtttaccagcatatcacacgaactgaaacgtgcacca
catctctggttccactgtccccaaccggcctggatgctgctctcggccaagttggtgacg
gggttggtttatatgctggtattattactggttgaatcaatattggtatactggctgttc
aacagctattcgcccgagcagaccggcataacaaaaacaaatatggcttcgtttataact
ggaattggtgcttatgtagctctcgctgttgttaacttcggcttgtatctcgcctcctgg
gcaactctattagcagtggtaaacgccagaggccgcaatctttggccggctgttctcgct
atcttctttgccgccacctggggaataaacagattcgagaaaacttggttttttgaaaaa
ttaacccactggggcaccattcaagcaaataccctgctatttaatggggaatacctgctg
tcgtcgggtaatataaatattagttttgctgccggtcaaatctatacaggtgaaaatttg
ttttatcttgttttagctatttccatattcgccctgtcggcctggctaattaaccgtaag
gttgaggtgtag

DBGET integrated database retrieval system