KEGG   Desulfallas gibsoniae: Desgi_3755Help
Entry
Desgi_3755        CDS       T02657                                 

Definition
(GenBank) alpha-glucan phosphorylase
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
dgi  Desulfallas gibsoniae
Pathway
dgi00500  Starch and sucrose metabolism
dgi01100  Metabolic pathways
dgi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dgi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Desgi_3755
Enzymes [BR:dgi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     Desgi_3755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3417 Phosphorylase
Motif
Other DBs
NCBI-ProteinID: AGL03077
UniProt: R4KNE1
LinkDB All DBs
Position
complement(3762312..3764858)
Genome map
AA seq 848 aa AA seqDB search
MFYFRTVTVNPPLPERIARLRDLSYNLWFSWHSPARELYREINPGLWEQVEHNPVKFLQR
VHREELDRVAANQHFLEKYDAVMARYDRYMSEEKWFQQTYPRFKDKNIAYFSAEFGLHES
LPIYSGGLGVLAGDHTKSASDLGLPFVGVGLLYKHGYFNQFINPEGRQETYYPDLNFNEM
PIIPVVGESGLDTTVSVELPGRTVHIRIWKVQVGLSQLILLDADLPLNMEEDRKITGQLY
GGGREMRIAQEIVLGVGGVRALRTLGITPAVWHINEGHSAFLTLERLREMVSQGVPSATA
REAIRANTIFTTHTPVPAGHDVFDRDMTEKYLAELCRDTGMDCDTLLELGWDAQQDEFNM
TVLAMRMAGFCNGVSKLHGEVTRQMLHRFYPAIPVEEVPVTSVTNGVHTRSWIAEVWKNI
FSQYLGENWADKVTDPAMWQRIDEIPDQVIWDTHMYLKEQAIQYIRDRIKKNCRRNHGSE
ALIAEAGGVLLPHALTIGFARRFATYKRAALIFNDPERLAAILNDLDRPVQIVFAGKAHP
KDGEGQELIKKIIDFSREEPFKGKIVFLENYDINVARHLVHGVDVWLNTPRWPMEASGTS
GMKAAMNGVLHCSVLDGWWPEAYNGKNGFAIGHPGDLQLHETQQDKSDTYYLYRVLEEKV
IPLYYDRQNDIPGQWAAMMRSSMRTIIPIFSTARMVMEYTDRLYAAAIDRGIAFMESNYA
AAEQACRFKRFIQENWHHVKVERTDSNGRWDMQAGEELVVGSVVKLGPIRPSEVAVEIAF
GSDQGPYISNLNTIIMELKETLGDGTYRYTGKVPLSQGTYGYTVRVRPAHQYMYGKFEIP
LVRWAECF
NT seq 2547 nt NT seq  +upstreamnt  +downstreamnt
atgttttatttccgtactgtaacggttaacccgccgctgccggagcgcattgcacgcctg
cgtgatctttcctataacctctggttcagctggcacagcccggccagggaactgtaccgg
gaaataaatcccgggctttgggaacaggtggaacataacccggttaaatttttacagcgg
gtgcaccgtgaggaactggaccgggttgccgccaaccagcattttttagaaaaatatgat
gctgtaatggccagatatgatcgctacatgagcgaggaaaagtggtttcaacaaacttat
ccccggttcaaggataaaaacattgcttatttttctgctgagtttggcttgcatgaatcc
ttgcccatttattcaggcggtctgggcgtgctggccggcgatcataccaaatcggccagc
gatttgggtttgccctttgtgggtgtaggtttattatataaacatggctattttaaccaa
ttcatcaaccctgaaggccgccaggaaacttattacccggatttgaattttaatgaaatg
cccattataccagtggtcggagaaagtggcctggataccactgtatcggtggagctgcca
ggcagaacggttcatataaggatatggaaggttcaggtggggctgtcgcagttaattctc
ctggatgctgatcttcccttgaacatggaagaggatcgcaaaattaccggtcagttatat
ggtggcgggcgtgaaatgcgtattgcccaggaaatagtgcttggcgtgggcggggtcagg
gctttaaggaccttgggtattactccggccgtatggcacattaatgaagggcactcggcc
tttttaacactggagcggctgcgggaaatggtcagccagggtgttccctcggccacagcc
cgggaagccatcagggccaataccatatttacaactcatactcccgtgcccgccggtcat
gatgtttttgaccgggatatgacagaaaaatatttggcagagttatgccgcgataccggc
atggactgtgatacattactggagctgggttgggacgcccagcaagatgagtttaatatg
acggttttagccatgcgtatggccggtttttgtaacggggtcagtaagctgcacggagaa
gtgacccgccaaatgttgcaccggttttaccccgctattccggtggaggaggtaccggtt
acttcggtgaccaatggggtacatacccgttcctggattgccgaagtatggaaaaatatt
tttagccagtacctgggggaaaactgggcggacaaggtaactgaccccgcaatgtggcaa
aggattgacgaaattccggaccaggtaatctgggatacacatatgtatttgaaagaacag
gccatccaatacatcagggatagaataaagaaaaattgccggcgcaatcacggttcagaa
gcacttattgccgaggccgggggtgttttactgccgcatgctttgaccattggttttgcc
cgccgctttgccacttacaagcgggccgcactgattttcaatgatccggaacgtctggct
gccatactcaacgatttggacaggccggtacaaatcgtgtttgccggtaaggcacatccc
aaagatggtgagggccaggagctaatcaaaaagatcatcgatttttcccgggaggagcct
tttaaaggtaaaattgttttcctggaaaattacgatattaatgtggcccgacatttggtt
cacggtgtagatgtatggctgaataccccccgctggcctatggaggccagcggcaccagt
ggcatgaaagctgcaatgaacggtgttctgcactgcagcgtgctggacggttggtggccc
gaggcatacaacggtaaaaacggttttgctattgggcatccaggtgatttacaattgcac
gaaacacagcaggataaaagtgatacttattatttatacagggtgcttgaggaaaaagta
ataccgctttattatgaccggcagaacgatattcccggccagtgggcggccatgatgcgc
agctccatgcgcacgataatacctattttcagtaccgcccggatggttatggagtatacg
gacaggctttatgctgcggcaattgaccggggcattgctttcatggaatcaaattatgca
gcggctgaacaagcttgccggtttaagaggtttattcaggagaactggcatcatgtaaag
gttgagcgtacggattccaatggtagatgggatatgcaggctggtgaggagctggtggtg
ggatcggtggtgaagctgggccctatcaggccttcggaagttgctgtggagatcgctttc
ggaagtgatcaagggccgtatatcagcaatttaaataccattattatggagttaaaggaa
acactgggggatggcacctaccgctataccggcaaagtacccctgtcccagggaacttat
ggctatactgtcagggtaaggcccgcccatcaatatatgtacggcaaatttgaaatcccc
ttggtgaggtgggcggaatgtttttaa

DBGET integrated database retrieval system