KEGG   Desulfallas gibsoniae: Desgi_3916
Entry
Desgi_3916        CDS       T02657                                 

Definition
(GenBank) pyrrolysine biosynthesis protein PylD
  KO
K16182  3-methylornithyl-N6-L-lysine dehydrogenase [EC:1.4.1.-]
Organism
dgi  Desulfallas gibsoniae
Pathway
dgi00300  Lysine biosynthesis
dgi01100  Metabolic pathways
dgi01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:dgi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    Desgi_3916
Enzymes [BR:dgi01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.-  
     Desgi_3916
SSDB
Motif
Pfam: NAD_binding_7 AlaDh_PNT_C 2-Hacid_dh_C ELFV_dehydrog XdhC_C TrkA_N Shikimate_DH AdoHcyase_NAD UDPG_MGDP_dh_N FAD_binding_3 ADH_zinc_N THF_DHG_CYH_C PglD_N Pyr_redox Sacchrp_dh_NADP IlvN
Other DBs
NCBI-ProteinID: AGL03208
UniProt: R4KJ12
LinkDB
Position
complement(3973714..3974517)
AA seq 267 aa
MTRLTETNLLGLETELRDYEDELLSKLGYSLKEIACKAAGIKVTYFDTLVKDHSIAVIPI
TAGKGLIGGFVQSVAAIIKYLGFEVFISEATDVAGFAEGLEQGASVLFMADDNRFLAFNK
FNGHLIDNTEATGRGFGSVLYGLASGLKGKKALVIGAGPVGRAAIDILKEFGAYVTVVDS
DQSKVIDLSGVCVERDLYKILPNYQYILDATPQADFLDRNYLHPRAAIAAPGVPLGLTPE
SRIEYSSRLVHDPLQIGVATMLAMVLK
NT seq 804 nt   +upstreamnt  +downstreamnt
ttgaccagacttacagaaactaacctgcttggtttggagacagaacttcgtgattatgaa
gatgaattactgtctaaattaggatatagtttaaaggaaattgcctgtaaggcagctggg
ataaaagttacatattttgatacattagtaaaagatcactcgattgcagtcatccctatt
actgcaggaaaaggtttgataggtggcttcgtacaatctgtcgctgctattatcaaatat
ttgggctttgaagtttttatttcggaagcgactgatgttgcagggtttgcagagggtcta
gaacagggtgcaagtgtattgttcatggctgatgataaccgtttcttggcatttaacaag
tttaatggacatctgattgataatactgaagcgacaggacgaggatttggttcagtactt
tacggacttgcctcaggattaaaaggtaaaaaagctttagttattggcgctggacccgta
ggacgcgcagctattgatattctaaaggaatttggcgcttatgtaacagtagtcgattct
gatcagtctaaggttatagatttatcaggcgtttgtgtagaaagggacttatataagata
ctgccaaattatcaatacattttagatgctacaccccaagcagattttttggatcgaaac
tatttacatccgagagctgcaattgcagcaccaggagtaccccttggacttacaccggaa
agcagaatagaatacagttcacgccttgtacatgatccacttcaaataggagttgctaca
atgttggcaatggttcttaaataa

DBGET integrated database retrieval system