KEGG   Deinococcus gobiensis: DGo_CA1493Help
Entry
DGo_CA1493        CDS       T01827                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
dgo  Deinococcus gobiensis
Pathway
dgo00620  Pyruvate metabolism
dgo00680  Methane metabolism
dgo01100  Metabolic pathways
dgo01120  Microbial metabolism in diverse environments
dgo01200  Carbon metabolism
Module
dgo_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:dgo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    DGo_CA1493
  09102 Energy metabolism
   00680 Methane metabolism
    DGo_CA1493
Enzymes [BR:dgo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     DGo_CA1493
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase
Motif
Other DBs
NCBI-ProteinID: AFD25420
UniProt: H8GU96
LinkDB All DBs
Position
complement(1624563..1627109)
Genome map
AA seq 848 aa AA seqDB search
MGIRSDVNLLGRTLGQVLKEQEGEAFFELVERTRALVRDVRAGGDDRELRDLIAGLNEAD
ASNLARAFTWYFQLVNLAEEYERVRVLSAQTGVRPQSLEQALLDLKAQGVGADEAEALLA
RLELELTFTAHPTEMRRRTVRNHLVEVARDIPQLSSPPIDEAAGERIAAHVEALWRTPEL
RRLKPTVQDEVKGGLNYVTSIAQALPMLQRDLSRAFARVYGRPTDARLPLRFSSWMGGDR
DGNPFVTPQATRETLALHRERARELMLRAISQAYADLSQEDETQEDGPAEGGDSAQTPEH
APYRTELRELHNAVRDGRTVELLPRLEALRGRMEAEGQHRSAEQLLTPLLSLARVFGQHL
VSLDIREHSGQTGAAVAELLRAAGVEADYLALPEHAKQELLTRELGSRRPLWPAGEPMPE
ALETAVGPIREVRDAARQVGPGAFGHYVISMSESVSDVLEPLLLAREVGFRVLPVPLFET
LGDLERAPQVVWELLSLPEYRAVLGGDVQEIMLGYSDSNKDAGFLAANWALHEAQRKISD
VCRRAGVHWRFFHGRGTSIGRGGGPASRAILGQPAGTIDAGIRITEQGEALADKYSHPVL
ARRNLEQALYGLMLAAARPTQDPPQAWMDAMDRAASSSAGAYRALVDDPEFIGFFERVTP
IHEISRLNIASRPVRRPGAPTLGNLRAIPWVMSWTQNRANLPGWYGLHAGLGEIGLETAR
DMYANWPFFRTVLDNAQMSLAKSDPLIFTEYLQLLGDVAGGERLAAHLQQAYRDTVEAVQ
AVVGTELLGNEPRLRESIGLRNPYIDPIHRIQVELLRRSRAEEGGLDEYERPLMLSLQGI
AAGVRNTG
NT seq 2547 nt NT seq  +upstreamnt  +downstreamnt
atgggcattcgcagtgacgtgaatctgctgggacgcacgctgggacaggtgctcaaggaa
caggaaggcgaggcctttttcgagctggtggagcgcacccgcgccctggtgcgcgacgtg
cgggccgggggcgacgaccgcgagctgcgcgacctgatcgcggggctgaacgaggccgac
gcctcgaatctcgcgcgggccttcacgtggtacttccagctcgtgaacctcgccgaggag
tacgagcgggtccgggtcctgagtgcccagaccggcgtgcggccccagagcctggagcag
gcgctgctggacctcaaggcgcagggcgtgggcgccgacgaggccgaggccctgctcgcg
cggctggagctggagctgaccttcaccgcgcacccgaccgagatgcggcggcgcacggtg
cgcaaccacctcgtcgaggtggcgcgcgacatcccgcagctcagcagcccccccatcgac
gaggcggcgggcgagcgcatcgccgcgcacgtcgaggcgctgtggcgcacgcccgagctg
cgccgcctgaagcccaccgtgcaggacgaggtcaagggcggcctgaactacgtgaccagc
atcgcccaggccctgccgatgttgcagcgcgacctctcgcgggccttcgcgcgggtgtac
ggccgccccacggacgcccgactgcccctgcgcttctcgtcgtggatggggggggaccgc
gacggtaaccccttcgtgacgccgcaggccacccgcgagacgctggcgctgcaccgcgaa
cgcgcccgcgaactcatgctgcgcgccatcagccaggcctacgccgacctgagccaggaa
gacgagacgcaggaggacggcccggccgagggcggggacagcgcgcagacccccgagcac
gccccctaccgcaccgaactgcgcgagctgcacaacgcggtgcgcgacgggcggacggtc
gagctgctgccccgcctggaggccctgcgcgggcgcatggaagccgagggccagcaccgc
agcgccgagcagctgctgacgccgctgctgagcctcgcgcgcgtgttcgggcagcacctc
gtgagcctagacatccgcgagcactcggggcagaccggcgcggcagtggccgagctgctg
cgcgcggcaggtgtcgaagccgactacctcgccctgcccgaacacgccaagcaggaactc
ctgacccgcgaactcgggtcgcggcggcccctgtggccggcgggcgaaccgatgccggaa
gcgctggaaacggcggtcggccccatccgcgaggtacgcgacgccgcgcggcaggtcggg
ccgggggctttcgggcattacgtcatcagcatgtccgagagcgtcagcgacgtgctcgaa
cccctgctgctggcgcgcgaggtgggcttccgggtgctgccggtgccgctgttcgagacg
ctgggcgacctggagcgcgccccgcaggtcgtgtgggaactgctctcgctgcccgagtac
cgcgcggtgctgggcggcgacgtgcaggagatcatgctgggctacagcgactcgaacaag
gacgcgggcttcctggcggccaactgggcgctgcacgaagcccagcgcaagatcagcgac
gtgtgccgccgcgccggcgttcactggcgctttttccacgggcgcggcacgagcatcggg
cgcgggggcggcccggccagccgcgcgatcctggggcagccggcgggcaccatcgacgcg
ggcatccgcatcaccgagcagggcgaggcgctggccgacaagtacagccaccccgtgctg
gcacggcgcaacctcgagcaggccctgtacggcctgatgctcgcggcggcccgccccacc
caggacccgccccaggcctggatggacgcgatggaccgcgccgcgtccagcagcgccggg
gcctaccgcgcgctggtagacgaccccgagttcatcggctttttcgagcgggtcacaccg
atccacgagatctcgcgcctgaacatcgcctcgcggccggtgcggcggcccggcgcgccc
accctgggcaacctgcgcgccattccctgggtcatgagctggacgcagaaccgcgccaac
ctgcccggctggtacggcctgcacgcgggcctgggcgagatcgggctggagacggcgcgg
gacatgtacgcgaactggccctttttccgcacggtcctggacaacgcccagatgagcctc
gccaagagcgaccccctgatcttcaccgagtacctccagctgttgggagacgtggcgggg
ggcgagcggctggccgcgcacctccagcaggcctaccgtgacaccgtggaggccgtgcag
gcggtcgtgggcaccgaactgctgggcaacgagccgaggctgcgcgagagcatcgggctg
cgcaacccgtacatcgaccccatccaccgcatccaggtcgagctgctgcgccggtcgcgc
gccgaggagggcggcctggacgagtacgagcgcccactcatgctgagccttcagggcatc
gcggcgggcgtgcgcaacaccggctga

DBGET integrated database retrieval system