KEGG   Deinococcus gobiensis: DGo_CA2318Help
Entry
DGo_CA2318        CDS       T01827                                 

Gene name
glpD
Definition
(GenBank) Glycerol-3-phosphate dehydrogenase, GlpA
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
dgo  Deinococcus gobiensis
Pathway
dgo00564  Glycerophospholipid metabolism
dgo01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dgo00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    DGo_CA2318 (glpD)
Enzymes [BR:dgo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     DGo_CA2318 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored NAD_binding_8 GIDA HI0933_like Pyr_redox_2 FAD_binding_3 Pyr_redox_3 TFB6
Motif
Other DBs
NCBI-ProteinID: AFD26245
UniProt: H8GZK7
LinkDB All DBs
Position
2460575..2462098
Genome map
AA seq 507 aa AA seqDB search
MVIGGGASGLGTAVEAATRGYRTLLLEAYDYAKGTSSRSTKLVHGGVRYLAQGNVSLVRE
ALHERGLLKKNAPHLVHDLGFVIAAYKWWSQPFYGIGLKVYDALAGRLNLQPSRLIGRDE
ALKKIPTFKKAGLKGGVLYFDGQFDDSRLAVTLLRTLEDHGGVALNYAPVTGLVKEKGPD
GKDKVAGVTFRDEESGQTLTVRARSVVNATGVFVDDIRRMDTPGAKPMLSPSQGVHVVVD
RKFLPGDSAIMVPRTDDGRVLFAVPWHDHVVIGTTDTPVPDASLEPRALPEEIDFILRTA
EQYMDPAPRREDVRSVYVGLRPLVKNENTDGAGSTAALSRDHIIRISDSGLLTLTGGKWT
TYRRMGEDAVNRAAVLGGLPERLTLTPGLKLHGWSSPEETARRADHWRVYGSDAERVQAL
PGADRQLHPELPYTEAEVRWAARAEQARTVEDVLSRRLRALLIGARASIEAAPRVAALLA
EELGHDEAWQRAQVEAYRQVADGYVLA
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
gtggtgatcgggggcggggcctcgggcctgggcaccgccgtcgaggccgccacgcgcggc
tacaggacgctgctgctcgaggcctacgactacgccaagggcacgtcgagccgcagcacc
aagctcgtgcacggcggcgtgcgctacctcgcccagggcaacgtgtcgctggtgcgcgag
gcgctgcacgagcgcgggctgctcaagaagaacgcgccgcatctggtccacgacctgggc
ttcgtcatcgccgcctacaaatggtggtcgcagcccttctacggcatcggcctgaaggta
tacgacgcgctcgcgggccggctcaacctccagcccagccgcctgatcggccgcgacgag
gccctgaagaagattccgaccttcaagaaggccggcctcaagggcggcgtgctgtacttc
gacggccagttcgacgactcgcgcctcgcggtgacgctgctgcgcaccctggaagaccac
ggcggcgtggccctgaactacgcccccgtgaccggcctggtcaaggaaaagggcccggac
ggcaaggacaaggtcgcgggcgtgaccttccgcgacgaggaaagcggccagaccctcacc
gtccgggcgcgcagcgtggtgaacgccacgggcgtgttcgtggacgacatccgccgcatg
gacacccccggcgccaagcccatgctctcgcccagccagggcgtgcacgtggtcgtggac
cgcaagttcctgccgggtgacagcgccatcatggtgccgcgcaccgacgacggccgggtg
ctgttcgccgtgccctggcacgaccatgtggtcatcggcacgaccgacaccccggtcccc
gacgccagcctggaaccgcgcgcgctgcccgaggagatcgacttcatcctgcgcaccgcc
gagcagtacatggacccggcccccaggcgcgaggacgtgcgcagcgtgtacgtgggcctg
cgcccgctggtgaagaacgagaataccgacggcgcgggcagcacggcggcgctgtcgcgc
gaccacatcatccgcatctcggactcgggcctgctgaccctgacgggcggcaagtggacg
acctaccgccgcatgggcgaggacgccgtgaaccgcgccgccgtgctgggcggcctgccc
gagcgcctgaccctgacgccggggttgaagctgcacggctggagcagccccgaggagacg
gcccgccgcgccgaccactggcgcgtgtacgggtcggacgccgagcgcgtgcaggccctg
cccggcgccgaccgccagctgcaccccgagctgccctacaccgaggccgaggtgcgctgg
gccgcccgcgccgagcaggcccgcaccgtcgaggacgtgctctcgcgccgcctgcgggcg
ctgctgatcggcgcgcgcgccagcatcgaggccgccccgcgcgtggccgccctgctggcc
gaggaactgggccacgacgaggcgtggcagcgcgcccaggtcgaggcctaccgtcaggtc
gccgacggctacgtgctggcctga

DBGET integrated database retrieval system