KEGG   Deinococcus gobiensis: DGo_PA0123Help
Entry
DGo_PA0123        CDS       T01827                                 

Definition
(GenBank) Glucan 1,4-alpha-glucosidase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
dgo  Deinococcus gobiensis
Pathway
dgo00500  Starch and sucrose metabolism
dgo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dgo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    DGo_PA0123
Enzymes [BR:dgo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     DGo_PA0123
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucodextran_N Glyco_hydro_15
Motif
Other DBs
NCBI-ProteinID: AFD27009
UniProt: H8H0Z0
LinkDB All DBs
Position
P1:144618..146816
Genome map
AA seq 732 aa AA seqDB search
MTFYLVMDGQEGPGGAVQGWVDLKRAAAYSLGVPAPHLPLPTVIHSGTHAGADYRLTLEV
LPDPQRDALLVRYALDGPFRLVVIAAPHLGGTGQDNVAWVDGALFAHHAGHVLCLSATGP
LRRASAGVVGVSDGWQDLQAHGRLTWAYTRAGPGNVALSAELEDRAGTLALGFSNTARGA
WTLARGALAEGYGAAEQEFLRGWGVWGDALKLPAPDPALGQLALLSAAVLKMHEDRTYPG
AIVASLSVPWGDSTDTLGGYHLVWPRDATLAAFALIAAGTPGDARRVLARFLATQQPDGH
WLQNTYPSGDPFWTGLQLDETAFPVLLAAKLREEGLEDLPGTAEMVGRALGFVVRTGPTS
DQDRWEENPGVNPFTLAVAVAALAAGAMWLPEAEREEALKVADEWNERLESWCYVQDTPL
AQELEVGGYYVRLAPPQRDGGLGGTVLLRNRMGETIGASALVSLDFSYLTRLGLRQADDP
RIVDTLKVVDHVLRVPTPSGDLYHRYNDDGYGEHEDGRPFDGSGIGRLWPLLSGERGHLA
LLSGEDPLPYLRTIAACASPGGLLPEQVWDAAPIPERGLYPGRPSGSAMPLVWTHAEFLK
LLLARETGRPAELLRAVGDRYARPRDAAEWRWRNETPLRQLPPGRDLTFESPVAFTLHFG
WDGWQDVQERQAQCGTFGLWLLTFRAEELRAHGSLNFTRRFGEAWEGADHEIRLERGAAR
EVTADQPDAARS
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atgacgttctatctggtcatggacgggcaggagggcccgggcggcgccgtccagggctgg
gtggacctcaaacgcgcggcggcctatagcctgggcgtgcccgcgccgcacctgccgctg
cccaccgtgatccacagcggcacgcacgccggggccgactaccgtctgacgctggaggtg
ctgcccgacccgcagcgcgacgccctgctcgtccgctacgcgctcgacggccccttccgg
ctcgtggtgatcgccgcgccgcacctggggggcaccggccaggacaacgtggcctgggtg
gacggcgcgctgttcgcccaccacgcgggccacgtgctgtgcctgagcgccaccgggccg
ctgcgccgcgcttcggcgggggtggtgggcgtgtccgacggctggcaggacctgcaggcc
cacgggcggctgacctgggcctacaccagggccggccccggcaacgtggccctgagcgcc
gagctggaagaccgcgccggcacgctggccctgggcttctcgaacacggcgcgcggggcc
tggaccctggcgcgcggcgcgctggccgaagggtacggggccgccgagcaggagttcctg
cggggctggggcgtctggggcgacgcgctgaagctgccggcccccgatcctgccctgggg
cagctcgccctgctcagcgccgccgtcctcaagatgcacgaggaccgcacctaccccggc
gccatcgtcgccagcctcagcgtgccctggggcgactcgaccgacacgctggggggctac
cacctggtctggccgcgagacgcgacgctggccgccttcgccctgatcgcggcgggcacg
cccggagacgcccggcgcgtcctggcgcgctttctcgccacgcagcagccggacggccac
tggctgcagaacacctaccccagcggcgaccccttctggaccgggctgcaactcgacgag
accgcctttccggtcctgctggccgccaaactgcgtgaagaaggcctggaggacctgccc
ggcaccgccgagatggtgggccgcgccctgggcttcgtggtgcgcaccggcccgaccagc
gaccaggaccgctgggaggaaaaccccggcgtgaacccgttcacgctggccgtcgccgtc
gcggcgctggcggcgggggccatgtggttgccggaggccgagcgcgaggaggccctgaag
gtggccgacgagtggaacgagcgcctggaaagctggtgctatgtccaggacacgccgctg
gcgcaagagctggaggtggggggctactacgtgcgcctggcgcccccgcagcgcgacggt
gggctgggcggcacggtgctgctgcgcaaccgcatgggcgagaccatcggcgcgtcggcc
ctggtcagcctggatttctcgtacctgacccgcctggggctgcggcaggcggacgacccg
cgcatcgtggacacgctgaaggtggtggaccatgtgctgcgtgtcccgacccccagcggc
gacctctaccaccgttacaacgacgacggttacggcgaacacgaggacggccgccctttc
gacggctcgggcatcgggcggctgtggccgctgctgtcgggcgaacgcgggcacctcgcg
ctgctgtcaggcgaggacccgctgccctacctgcggaccatcgcggcctgtgccagtccc
ggcggcctgctgcccgagcaggtctgggacgcggcccccatcccggagcgcggcctgtat
ccggggcggccctcaggcagcgccatgccgctggtgtggacccacgccgaattcctgaag
ttgctgctggcgcgtgaaacaggccgccccgccgagctgctgcgggcggtcggggaccgc
tatgcccggcccagggacgccgccgagtggcgctggcgcaacgagacgccgctgcgccag
ctgccgccggggcgcgacctgaccttcgagagtccggtggccttcacgctccacttcggc
tgggacggctggcaggacgtgcaagagcgtcaggcgcagtgtggcaccttcggcctgtgg
ctgctgaccttccgggccgaggaactgcgcgcgcacggcagcctgaatttcacccggcgc
ttcggggaggcctgggagggagccgaccacgaaatccggctggagcgcggcgcggccagg
gaggtcacggcagaccagccggacgcggcgcgcagctga

DBGET integrated database retrieval system