KEGG   Drosophila grimshawi: Dgri_GH10147
Entry
Dgri_GH10147      CDS       T01061                                 

Definition
(RefSeq) GH10147 gene product from transcript GH10147-RA
Organism
dgr  Drosophila grimshawi
SSDB
Motif
Pfam: SecB
Other DBs
NCBI-GeneID: 6562830
NCBI-ProteinID: XP_001989263
FlyBase: FBgn0117628
UniProt: B4JC97
LinkDB
AA seq 146 aa
MLTDEAPPPLDPQQPVLYIECCQSQADYRHRALELHLGLAEALRAMNPEVRLQLRLNENN
AAREGAFEVAIAATPTADVDARHMLWTGLRRVPQSAKVPNVDDIIAPACLVLKLRHSQAG
SSSINLVRTSDGEISKIIQRHGRRSL
NT seq 441 nt   +upstreamnt  +downstreamnt
atgcttacggacgaggcgccaccgccattggatccccaacaaccggtgctctatattgaa
tgctgtcaaagtcaggcagattatcggcatcgcgctttggaactgcatttggggctggcg
gaggcgctgcgtgccatgaatcccgaggtgcgacttcagttgcgcctcaacgagaacaat
gctgcacgtgagggcgcctttgaagtggcaattgcggccacgcccaccgcagatgttgac
gcccgccatatgctctggacgggcttgaggcgagtgccccaatcggcaaaggtgcccaat
gtcgatgacatcattgcgccagcctgtctggtcctgaaactccggcacagccaggcgggc
agcagcagcatcaacctggtccgcaccagcgatggcgagatcagcaaaatcatccagcga
catggcagacgcagcttgtaa

DBGET integrated database retrieval system